SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022346 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022346
Domain Number 1 Region: 225-307
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.76e-31
Family PHD domain 0.0000168
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000022346
Domain Number - Region: 73-136
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00662
Family PHD domain 0.026
Further Details:      
 
Domain Number - Region: 157-210
Classification Level Classification E-value
Superfamily RING/U-box 0.0161
Family RING finger domain, C3HC4 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022346   Gene: ENSMMUG00000016984   Transcript: ENSMMUT00000023875
Sequence length 381
Comment pep:known chromosome:MMUL_1:2:83955518:83969521:-1 gene:ENSMMUG00000016984 transcript:ENSMMUT00000023875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLKEKKERQRLRKSAKTRRVTQRKPSSGPVCWLCLQEPGDPEKLGEFLQKDNISVHYF
CLILSSKLPQRGQSNRGFHGFLPEDIKKEAARASRKICFVCKKKGAAINCQKDQCIRNFH
LPCGQEKGCLSQFFGEYKSFCDKHRPAQNIQHGNMGEESCILCCEDLSQQSVENIQSPCC
SQAIYHRKCIQKYAHTSAKHFFKCPQCNNRKEFPQEMLRMGIHIPDRDAAWELEPGAFSD
LYQRYQHCDAPICLYEQGRDSFEDEGRWCLILCDTCGSHGTHRDCSSLRSNSKKWECEEC
SPAAATDYIPENSGDIPCCSSTFHPEEHFCRDNTLEENPGLSWTDWPEPSLLEKPESSRG
RRSHSWRSKGVRITNSCKKSK
Download sequence
Identical sequences A0A2K6CSW1 F6PSI8 Q4R7C9
ENSMMUP00000022346 9544.ENSMMUP00000022346 ENSMMUP00000022346 NP_001244998.1.72884 NP_001271077.1.63531 XP_011737884.1.29376 XP_014986028.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]