SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022370 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022370
Domain Number 1 Region: 60-159
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 1.7e-21
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.0017
Further Details:      
 
Domain Number 2 Region: 162-215
Classification Level Classification E-value
Superfamily Head domain of nucleotide exchange factor GrpE 4.84e-16
Family Head domain of nucleotide exchange factor GrpE 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022370   Gene: ENSMMUG00000017003   Transcript: ENSMMUT00000023899
Sequence length 217
Comment pep:known chromosome:MMUL_1:5:1733310:1743387:1 gene:ENSMMUG00000017003 transcript:ENSMMUT00000023899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQCVRLARRSLPALALSLRPSPRLLCTATKQKNSGQNLEEDVGQSEQKADPPATEKTL
LEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEK
ATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFH
TPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA
Download sequence
Identical sequences A0A0D9RU27 A0A2K6CZU7 F6PNE3 G7P574
NP_001248480.1.72884 NP_001273071.1.63531 XP_008016191.1.81039 XP_011743270.1.29376 XP_011743271.1.29376 ENSMMUP00000022370 9544.ENSMMUP00000022370 ENSMMUP00000022370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]