SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022383 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022383
Domain Number 1 Region: 82-242
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000000157
Family Proline iminopeptidase-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022383   Gene: ENSMMUG00000017009   Transcript: ENSMMUT00000023912
Sequence length 514
Comment pep:known chromosome:MMUL_1:4:27011674:27018638:1 gene:ENSMMUG00000017009 transcript:ENSMMUT00000023912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVWLARWLGPLLLVSLWGLSAPASLLRRLGEHIQQFQESSAQGLGLSLGPGAAALPKVG
WLEQLLDPFNVSDRRSFLQRYWVNEQHWVGEDGPIFLHLGGEGSLGPGSVMRGHPAALAP
AWGALVISLEHRFYGLSIPAGGLEMAQLRFLSSRHALADVVSARLALSRLFNISSSSPWI
CFGGSYAGSLAAWARLKFPHLIFASVASSAPVRAVLDFSEYNDVVSRSLMSTAIGGSLEC
RAAVSAAFAEVERRLRLGGAAQAALRSELSACGTLGSAENQAELLGALQALVGGAVQYDG
QAGAPLSVRQLCGLLLGGGGNRSHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRS
TEPQLSGVGDRQWLYQTCTEFGFYVTCGNPRCPFSQLPALPSQLDLCEKVFGLSALSVAQ
AVAQTNSYYGGQTPGANQVLFVNGDTDPWHVLSVTQALGSSESALLIRTGSHCLDMAPER
PSDSPSLRLGRQNIFQQLQTWLKLAKESQVKGEV
Download sequence
Identical sequences XP_001094051.1.72884 ENSMMUP00000022383 9544.ENSMMUP00000022383 ENSMMUP00000022383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]