SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022411 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022411
Domain Number 1 Region: 119-422
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 8.27e-102
Family Pancreatic carboxypeptidases 0.00000526
Further Details:      
 
Domain Number 2 Region: 22-110
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 1.19e-18
Family Pancreatic carboxypeptidase, activation domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022411   Gene: ENSMMUG00000017029   Transcript: ENSMMUT00000023942
Sequence length 423
Comment pep:known chromosome:MMUL_1:17:24927049:24984505:-1 gene:ENSMMUG00000017029 transcript:ENSMMUT00000023942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLCSLAVLVPIVLFCEQHVFAFQSGQVLAALPRTSRQVQVLQNLTTTYEIVLWQPVTSD
LIAKKKQVHFFVNSSDVDIVKSHLNVSGILCSVLLADVEDLIQQQISNDTVSPRASASYY
EQYHSLNEIYSWIELITEKYPDMLTKIHIGSSYEKHPLYVLKVSGKEQTAKNAMWIDCGI
HAREWISPAFCLWFIGHITEHYGIIGEYTNLLRHVDFYVMPVVNVDGYDYSWKKNRMWRK
NRSFYANNRCIGTDLNRNFASKHWCEEGASSFSCSETYCGLYPESEPEAKAVANFLRRNI
NHIKAYISMHSYSQHIVFPYSYTRSKSKDHEELSLVASEAVRAIQKTSKNIRYTHGRGSE
TLYLAPGGADDWIYDLGIKYSFTIELRDTGKYGFLLPERYIKPTCKDAFAAVSKIAWHVI
RNV
Download sequence
Identical sequences 9544.ENSMMUP00000022411 ENSMMUP00000022411 XP_001097608.1.72884 ENSMMUP00000022411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]