SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022413 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022413
Domain Number 1 Region: 39-211
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.39e-34
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.000000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022413   Gene: ENSMMUG00000007174   Transcript: ENSMMUT00000023944
Sequence length 225
Comment pep:known chromosome:MMUL_1:10:66074874:66077945:1 gene:ENSMMUG00000007174 transcript:ENSMMUT00000023944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLVGSGAAVVWLRAGAAGPDAVHPGERAAGAQGAPGPSFQADFSDNGRPGFQEQRYPRPL
GESGPTLDIPVLSIFNDISQDWAFVSWVWYEREVTLLKRWIQDLYTRVVLRIGSAHFYAI
VWVNGVHTLDHERGYLPFEADISSLFPVGHLPSRLCVTVTINSTLTPTLPPGTIYLTDTS
KYPKGYFVQNTDFDFFNYAGLQQSVLLYMTPITCIDDITITTGVE
Download sequence
Identical sequences ENSMMUP00000022413 ENSMMUP00000022413 9544.ENSMMUP00000022413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]