SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022465 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022465
Domain Number 1 Region: 12-313
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 6.44e-69
Family Leucine carboxy methyltransferase Ppm1 0.0038
Further Details:      
 
Domain Number 2 Region: 480-667
Classification Level Classification E-value
Superfamily Kelch motif 2.22e-21
Family Kelch motif 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000022465
Domain Number - Region: 352-435
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.000157
Family Galactose oxidase, central domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022465   Gene: ENSMMUG00000017066   Transcript: ENSMMUT00000024000
Sequence length 686
Comment pep:known chromosome:MMUL_1:7:21764717:21766774:-1 gene:ENSMMUG00000017066 transcript:ENSMMUT00000024000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRNRERRAGAVQSTNDSSALSKRSLAARGYVQDPFAALLVPGAARRAPLIHRGYYIRA
RAVRHCVRAFLEQTGALHAARRAQILSLGAGFDSLYFRLKTAGRLARAAVWEVDFPNVAR
RKAERIGETPELCALTGPFQRGEPASALCFESADYCILGLDLRQLQRVDEALGAAGLDAA
SPTLLLAEAVLTYLETESAAALIAWAAQRFPNALFVVYEQMRPQDAFGQFMLQHFRQLNS
PLHGLERFPDVEAQRRRFLQAGWTACGAVDMNEFYRCFLPAEERRRVENIEPFDEFEEWH
LKCAHYFILAASRGDILSHTLVFPSSEAFPRLNPASPSGVFPASVVSSEGQVPNLKRYGH
ASVLLSPDVILSAGGFGEQEGRHCRVSQFHLLSRDGDSEWKGSQIGDCGTGVQWDGRLYH
TMTRLSESRVLVLGGRLSPVSPALGVLQLHFCNSEDNNTQDLKVTITKAGPKNDSTLSCW
RHSTTEVSYQNQEYLFVYGGRSVVEPVLSDWHFLHVETMAWVRIPVEGEVPEARHSHSAC
TWQGGALIAGGLGASEEPLNSVLFLRPTSCGFLWESIDIQPPITPRYSHTAHVLNGKLLL
VGGVWIHSSSFPGVTVINLTTGLSSEYEIDTTYVPWPLMLHNHTSILLPEEQQLLLLGGG
GNCFSFGTYFNPHTVTLDLSSLSAGQ
Download sequence
Identical sequences ENSMMUP00000022465 ENSMMUP00000022465 9544.ENSMMUP00000022465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]