SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022591 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022591
Domain Number 1 Region: 70-315
Classification Level Classification E-value
Superfamily SET domain 8.63e-80
Family Histone lysine methyltransferases 0.0000204
Further Details:      
 
Domain Number 2 Region: 2-38
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000176
Family Chromo domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022591   Gene: ENSMMUG00000017174   Transcript: ENSMMUT00000024144
Sequence length 350
Comment pep:known chromosome:MMUL_1:9:15154664:15177958:1 gene:ENSMMUG00000017174 transcript:ENSMMUT00000024144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYYLVKWKGWPDSTNTWEPLQNLKCPLLLQQFSNDKHNYLSQVKKGKAITPKNNNKTLK
PAIAEYIVKKAKQRIALQRWQDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPG
ISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCP
NRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNK
GITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTR
TINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN
Download sequence
Identical sequences A0A2K5UW32 A0A2K6B876 A0A2K6M3R4 F7GYV0
ENSMMUP00000022591 9544.ENSMMUP00000022591 ENSMMUP00000022591 ENSMMUP00000022592 XP_002805607.1.72884 XP_005564737.1.63531 XP_005564738.1.63531 XP_008000538.1.81039 XP_008000539.1.81039 XP_008000540.1.81039 XP_010364273.1.97406 XP_010364274.1.97406 XP_010364275.1.97406 XP_011754783.1.29376 XP_011754784.1.29376 XP_011754786.1.29376 XP_011754787.1.29376 XP_011789643.1.43180 XP_011789644.1.43180 XP_015002009.1.72884 XP_015002010.1.72884 XP_015311074.1.63531 XP_017729834.1.44346 XP_017729842.1.44346 XP_017729850.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]