SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022610 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022610
Domain Number 1 Region: 108-481
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.58e-72
Family WD40-repeat 0.00012
Further Details:      
 
Domain Number 2 Region: 1238-1361
Classification Level Classification E-value
Superfamily Bromodomain 1.57e-32
Family Bromodomain 0.00028
Further Details:      
 
Domain Number 3 Region: 1088-1199
Classification Level Classification E-value
Superfamily Bromodomain 1.3e-25
Family Bromodomain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022610   Gene: ENSMMUG00000017186   Transcript: ENSMMUT00000024165
Sequence length 1758
Comment pep:known chromosome:MMUL_1:4:75029575:75143304:-1 gene:ENSMMUG00000017186 transcript:ENSMMUT00000024165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKYYRHLAPDHLLQICHRLGPLLEQEIPQSVPGVQTLLGAGRQSLLRTNKSCKHVVWKGS
ALAALHCGRPPESPVNYGSPPSIADTLFSRKLNGKYRLERLVPTAVYQHMKMHKRILGHL
SSVYCVTFDRTGRRIFTGSDDCLVKIWATDDGRLLATLRGHAAEISDMAVNYENTMIAAG
SCDKMIRVWCLRTCAPLAVLQGHSASITSLQFSPLCSGSKRYLSSTGADGTICFWLWDAG
TLKINPRPAKFTERPRPGVQMICSSFSAGGMFLATGSTDHIIRVYFFGSGQPEKISELEF
HTDKVDSIQFSNTSNRFVSGSRDGTARIWQFKRREWKSILLDMATRPAGQNLQGIEDKIT
KMKVTMVAWDRHDNTVITAVNNMTLKVWNSYTGQLIHVLMGHEDEVFVLEPHPFDPRVLF
SAGHDGNVIVWDLARGVKIRSYFNMIEGQGHGAVFDCKCSPDGQHFACTDSHGHLLIFGF
GSSSKYDKIADQMFFHSDYRPLIRDANNFVLDEQTQQAPHLMPPPFLVDVDGNPHPSRYQ
RLVPGRENCREEQLIPQMGVTSSGLNQVLSQQANQEISPLDSMIQRLQQEQDLRRSGEAA
ISNTNRLSRGSVSSTSEVHSPPNVGLRRSGQIEGVRQMHSNAPRSEIATERDLVAWSRRV
VVPELSAGIASRQEEWRTAKGEEEIKTYRSEEKRKHLTVPKENKIPTVSKNHAHEHFLDL
GESKKQQTNQHNYRTRSALEETPRPSEEIENGTSSSDEGEVVAVSGGTSEEEERAWHSDG
SSSDYSSDYSDWTADAGINLQPPKKVPKNKTKKAESSSDEEEESEKQKQKQIKKEKKKVN
EEKDGPISPKKKKPKERKQKRLAVGELTENGLTLEEWLPSTWITDTIPRRCPFVPQMGDE
VYYFRQGHEAYVEMARKNKIYSINPKKQPWHKMELREQELMKIVGIKYEVGLPTLCCLKL
AFLDPDTGKLTGGSFTMKYHDMPDVIDFLVLRQQFDDAKYRRWNIGDRFRSVIDDAWWFG
TIESQEPLQLEYPDSLFQCYNVCWDNGDTEKMSPWDMELIPNNAVFPEELGTSVPLTDGE
CRSLIYKPLDGEWGTNPRDEECERIVAGINQLMTLDIASAFVAPVDLQAYPMYCTVVAYP
TDLSTIKQRLENRFYRRVSSLMWEVRYIEHNTRTFNEPGSPIVKSAKFVTDLLLHFIKDQ
TCYNIIPLYNSMKKKVLSDSEEEEKDADVPGTSTRKRKDHQPRRRLRNRAQSYDIQAWKK
QCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMDFATVRETLEAGNYESPMELCK
DVRLIFSNSKAYTPSKRSRIYSMSLRLSAFFEEHISSVLSDYKSALRFHKRNTITKRRKK
RNRSSSVSSSAASSPERKKRILKPQLKSEISTSAFSTPTRSIPPRHNAAQINGKTESSSV
VRTRSNRVIVDPLITEQPSTSSAAKTFITKANASAIPGKTILENSVKHSKALNTLSSPGQ
SNFSHGTRNNSAKETMEKEKPVKRKMKSSILPKASTLSKSSAVIEQGDCKNNALVPGTIQ
VNGHGGQPSKLVKRGPGRKPKVEVNTNSGEIIHKKRGRKPKKLQYAKPENLEQNNVHPIR
DEVLPSSTCNFLSETNNVKEDLLQKKSRGGRKPKRKMKTQKLDSDLLVPASVKVLRRSNR
KKIDDPIDEEEEFEELKGSEPHMRTRNQGRRTAFYNEDDSEEEQRQLLFEDTSLTFGTSS
RGRVRKLTEKAKANLIGW
Download sequence
Identical sequences ENSMMUP00000022610 ENSMMUP00000022610 9544.ENSMMUP00000022610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]