SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022759 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000022759
Domain Number - Region: 48-100
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 0.00385
Family Pyruvate kinase, C-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022759   Gene: ENSMMUG00000017301   Transcript: ENSMMUT00000024316
Sequence length 133
Comment pep:known chromosome:MMUL_1:1:35683967:35690239:-1 gene:ENSMMUG00000017301 transcript:ENSMMUT00000024316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCLRLGGLSVGDFRKVLMKTGLVLVVLGHVSFITAALLHGTVLRYVGTPQDAVALQYCVV
NILSVTCAIVVITSGIAAIVLSRYLPSTPLRWTVFSSSVACALLSLTCALGLLASIAVTF
ATQGKALLAACTF
Download sequence
Identical sequences ENSMMUP00000040444 9544.ENSMMUP00000040444 ENSMMUP00000022759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]