SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022789 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022789
Domain Number 1 Region: 1083-1382
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.19e-65
Family Tandem AAA-ATPase domain 0.0000374
Further Details:      
 
Domain Number 2 Region: 808-1081
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.19e-59
Family Tandem AAA-ATPase domain 0.000064
Further Details:      
 
Domain Number 3 Region: 2542-2627
Classification Level Classification E-value
Superfamily BRK domain-like 2.62e-22
Family BRK domain-like 0.0000225
Further Details:      
 
Domain Number 4 Region: 2479-2547
Classification Level Classification E-value
Superfamily BRK domain-like 0.00000000000000327
Family BRK domain-like 0.00044
Further Details:      
 
Domain Number 5 Region: 686-749
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000000385
Family Chromo domain 0.018
Further Details:      
 
Domain Number 6 Region: 761-826
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000317
Family Chromo domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022789   Gene: ENSMMUG00000016310   Transcript: ENSMMUT00000024348
Sequence length 2899
Comment pep:known chromosome:MMUL_1:20:51290808:51563513:1 gene:ENSMMUG00000016310 transcript:ENSMMUT00000024348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDPMMDFFDDANLFGETLEGLSDDAFVQPGPVSLVDELNLGAEFEPLHIDSLNHVQSTP
AHQKMTDFEQLNQFDSIKFHHVNQSFGSPAEHVLSPHSQFNCSPIHPQNQPNGLFPDVSD
GSPMWGHQTSTNISNQNGSPFHQQGHSHSMHQNKSFVAHHDFALFQANEQQTQCTSLRSQ
QNRNNLNPGQNSLSQSKNFMNVSGPHRVNVNHPPQMTNASNSQQSISMQQFSQTSNPSAH
FHKCSNHQEGNFNGPSPNMTSCSVSNSQQFSSHYSFSSNHISPNSLLQSSAVLAPNHANQ
TLSDFTGSNSFSPHRGIKQESTQHILNPNTSLNSNNFQILHSSHPQGNYSNSKLSPVHMN
FPDPVDSGTQMGHFNDHVETNGFSSLEENLLHQVESQTEPFTGLDPEDLLQEGLLPHFDE
STFGQDNSSHILDHDLDRQFTSHLVTRPSDMAQTQLQSQARSWHSSFSNHQHLHDRNHLC
LQRQPPSSKKSDGSGTYTKLQNTQVRVMSEKKQRKKVESESKQEKANRIISEAIAKAKER
GERNIPRVMSPENFPSASVEGKEEKKGRRMKSKPKDKDSKKTKTCSKLKEKTKIGKLIIT
LGKKQKRKNESSDEISDAEQMPQHTLKDQDSQKRRSNRQIKRKKYAEDVEGKQSEEEVKG
SMKIKKNSAPLPGEQPLQLFVENPSEEDAAIVDKILSSRIVKKEISPGVMIDTEEFFVKY
KNYSYLHCEWATEEQLLKDKRIQQKIKRFKLRQAQRAHFFADMEEEPFNPDYVEVDRVLE
VSFCEDKDTGEPVIYYLVKWCSLPYEDSTWELKEDVDLAKIEEFEQLQASRPDTRRLDRP
PSNIWKKIDQSRDYKNGNQLREYQLEGLNWLLFNWYNRRNCILADEMGLGKTIQSITFLY
EILLTGIRGPFLIIAPLSTIANWEREFRTWTDINVVVYHGSLISRQMIQQYEMYFRDSQG
RIIRGAYRFQAIITTFEMILGGCGELNAIEWRCVIIDEAHRLKNKNCKLLEGLKLMNLEH
KVLLTGTPLQNTVEELFSLLHFLEPLRFPSESTFMQEFGDLKTEEQVQKLQAILKPMMLR
RLKEDVEKKLAPKEETIIEVELTNIQKKYYRAILEKNFSFLSKGAGQTNVPNLVNTMMEL
RKCCNHPYLIKGAEEKILGEFRDAYNPAASDFHLQAMIQSAGKLVLIDKLLPKMKAGGHK
VLIFSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRA
GGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQNKAVKVYRLVTRNSYEREMFDRA
SLKLGLDKAVLQSMSGRESNVGGIQQLSKKEIEDLLRRGAYGAIMEEEDEGSKFCEEDID
QILLRRTKTITIESEGRGSTFAKASFVASGNRTDISLDDPNFWQKWAKKAEIDIEAISGR
NSLVIDTPRIRKQTRPFSATKDELAELSEAESEGDEKPKLRRPCDRSNGYGRTECFRVEK
NLLVYGWGRWREILSHGRFKRQLNEHDVEIICRALLAYCLVHYRGDEKIKGFIWDLITPT
EDGQTRELQNHLGLSAPVPRGRKGKKVKTQTSSFDIQKAEWLRKYNPEQLLQDEGYKKHI
KHHCNKVLLRVRMLYYLKQEVIGSECQKVFDGVDASDIDVWVPEPDHSEVPAEWWDFDAD
KSLLIGVFKHGYEKYNTIRADPALCFLERVGKPDDKAVAAEQRANDYMDGDVEDPEYKPA
PAIFKDDIEDDVSSPGDLVIADGDGQLMEGDKVYWPTQSALTTRLRRLITAYQRTNKNRQ
IQQIQPTFSVPTSVMQPIYEEATLNPKMAAKIERQQRWTRREEADFYRVVSTFGVVFDPD
RGQFDWTKFRAMARLHKKTDDSLEKYLYAFMSMCRRVCRLPSKEELVDPNIFIQPITEER
ASRTLYRIELLRKVREQALRHPQLFERLKLCHPNPDLPVWWECGPHDRDLLIGAAKHGVS
RTDYHILRDPELSFMAAQRSYSQSKIAHSRTSTPLLQQYQVALSASPLTSLPRLLDAKGI
ILEEMKVKSENLKEEPQSSEEESMSSVETRTLIKSEPVSPKNGVLPQATGDQKSGGKNET
DRRMVAARTEPLTPNPASKKPRVHKRGSESSSDSDSDSERSSCSSRSSSSSSSSSSCSHS
RSGSSSSSSSSCSSASSSSSSTSSSSSSSSSSEESDSDEEEAQKRESTTHMKAYDEESVA
SLSTTQDETQDSFQMNNGTPESAYILQGGYMLAASYWPKDRVMINRLDSICQTVLKGKWP
SARRSYDANTVASFYTTKLLDSPGAATEYSEPSVPTPPGAGVKEEHDQSTQMSKVKKHVR
EKEFTVKIKDEGGLKLTFQKQGLAQKRPFDGEDGALGQQQYLTRLRELQNASETSLVNFP
KSIPVSGTSIQPTLGANGVILDNQPIVKKRRGRRKNVEGVDIFFFNRSKPPNHVSLGLTS
SQISTGINPALSYTQPQGISDTESPVPVINLKDGTRLAGDDAPKRKDLEKWLKEHPGYVE
DLGAFIPRMQLHEGRPKQKRHRCRNPNKLDVNSLTGEERVQLINRRNARKVGGAFAPPLK
DLCRFLKENSEYGVAPEWGDVVKQSGFLPESMYERILTGPVVREEVSRRGRRPKSGIAKA
TAAAAAAASATSVSGNPLLANGLLPGVDLTTLQALQQNLQNLQSLQVTAGLMGMPTGLSS
GGEAKNMAAMFPMLLSGMAGLPNLLGMGGLLTKPTESGTEDKKGSDSKESEGKKERTESQ
SSENGGENSVSSSPSTSSTAALNTAAAANPLALNPLLLSNILYPGMLLTPGLNLHIPTLS
QSNTFDVQNKNKNSDLGSSKSVEVKEEDSRIKDQEDKGGTEPSPLNENSTDEGSEKADAS
SGSDSTSSSSEDSDSSNED
Download sequence
Identical sequences ENSMMUP00000022789 9544.ENSMMUP00000021427 ENSMMUP00000021427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]