SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023040 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023040
Domain Number 1 Region: 817-1007
Classification Level Classification E-value
Superfamily Fibronectin type III 2.48e-32
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 2 Region: 616-813
Classification Level Classification E-value
Superfamily Fibronectin type III 1.25e-29
Family Fibronectin type III 0.0000539
Further Details:      
 
Domain Number 3 Region: 254-343
Classification Level Classification E-value
Superfamily Immunoglobulin 1.87e-20
Family I set domains 0.011
Further Details:      
 
Domain Number 4 Region: 528-622
Classification Level Classification E-value
Superfamily Immunoglobulin 1.1e-19
Family I set domains 0.011
Further Details:      
 
Domain Number 5 Region: 336-431
Classification Level Classification E-value
Superfamily Immunoglobulin 4.6e-17
Family I set domains 0.0042
Further Details:      
 
Domain Number 6 Region: 39-143
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000548
Family I set domains 0.0094
Further Details:      
 
Domain Number 7 Region: 146-233
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000111
Family I set domains 0.021
Further Details:      
 
Domain Number 8 Region: 1121-1196
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000206
Family Fibronectin type III 0.0051
Further Details:      
 
Domain Number 9 Region: 428-504
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000854
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023040   Gene: ENSMMUG00000017508   Transcript: ENSMMUT00000024615
Sequence length 1340
Comment pep:known chromosome:MMUL_1:1:165399984:165480410:-1 gene:ENSMMUG00000017508 transcript:ENSMMUT00000024615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPLQQNSLTQPPTITKQSVKDHIVDPRDNIL
IECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFA
RNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVA
ERTPSFMYPQGTASSQMVLRGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKA
LRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLAN
AFVSVLDVPPRMLSPRNQLIRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHV
YENGKLCSIHTTAYCLAGICHCVAAWGCWAENRPVASALGFSTDPTRIYRMPEDQVAKRG
TTVQLECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVAST
ELDQDLAKAYLTVLGRPDRPRDLELTDLAERSVRLTWIPGDDNNSPITDYVVQFEEDQFQ
PGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAVNEVGSSHPSLPSERYRTSGAPPESNP
GDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVTVWGSRYVVGQT
PVYVPYEIRVQAENDFGKGPEPESVIGYSGEDYPRAAPTEVKVRVMNSTAISLQWNRVYP
DTVQGQLREYRAYYWRESSLLKNLWVSQKRQQASFPGDRLRGVVSRLFPYSNYKLEMVVV
NGRGDGPRSETKEFTTPEGVPSAPRRFRVRQPNLETINLEWDHPEHPNGIMTGYTLKYVA
FNGTKVGKQIVENFSPNQTKFTVQRTDPVSRYRFTLSARTQVGSGEAVTEESPAPPNEGR
CMAAAPGVKAPPTLPPTTVGATGAVSSTDATAIAATTEATTVPIIPTVAPTTIATTTVAT
TTTATAATTTTESPPTTTSGTKIHESAPDEQSIWNVTVLPNSKWANITWKHNFGPGTDFV
VEYIDSNHTKKTVPVKAQAQPIQLTDLYPGMTYTLRVYSRDNEGISSTVITFMTSTAYTN
NQADIATQGWFIGLMCAIALLVLILLIVCFIKRSRGGKYPVREKKDVPLGPEDPKEEDGS
FDYSDEDNKPLQGSQTSLDGTIKQQESDDSLVDYGEGGEGQFNEDGSFIGQYTVKKDKEE
TEGNESSEATSPVNAIYSLA
Download sequence
Identical sequences ENSMMUP00000023047 ENSMMUP00000023040 9544.ENSMMUP00000023047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]