SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023043 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023043
Domain Number 1 Region: 842-938
Classification Level Classification E-value
Superfamily PDZ domain-like 1.16e-25
Family PDZ domain 0.0000857
Further Details:      
 
Domain Number 2 Region: 693-795
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-25
Family PDZ domain 0.0000944
Further Details:      
 
Domain Number 3 Region: 156-262
Classification Level Classification E-value
Superfamily PDZ domain-like 9.46e-24
Family PDZ domain 0.0000258
Further Details:      
 
Domain Number 4 Region: 529-627
Classification Level Classification E-value
Superfamily PDZ domain-like 6.7e-23
Family PDZ domain 0.00037
Further Details:      
 
Domain Number 5 Region: 320-432
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-22
Family PDZ domain 0.00022
Further Details:      
 
Domain Number 6 Region: 45-84
Classification Level Classification E-value
Superfamily WW domain 0.000000000501
Family WW domain 0.0028
Further Details:      
 
Domain Number 7 Region: 1-28
Classification Level Classification E-value
Superfamily WW domain 0.000000371
Family WW domain 0.0031
Further Details:      
 
Domain Number 8 Region: 94-124
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000011
Family beta-sandwich domain of Sec23/24 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023043   Gene: ENSMMUG00000017510   Transcript: ENSMMUT00000024619
Sequence length 1192
Comment pep:known chromosome:MMUL_1:2:70915090:71054525:1 gene:ENSMMUG00000017510 transcript:ENSMMUT00000024619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYTENGEVYFIDHNTKTTSWLDPRCLNKQQKPLEECEDDEGVHTEELDSELELPAGWEK
IEDPVYGIYYVDHINRKTQYENPVLEAKRKKQLEQQQQQQQQQQQQQQQQQQQQQQQQQQ
QQTEEWTEDHSALVPPVIPNHPPSNPEPAREAPLQGKPFFTRNPSELKGKFIHTKLRKSS
RGFGFTVVGGDEPDEFLQIKSLVLDGPAALDGKMETGDVIVSVNDTCVLGHTHAQVVKIF
QSIPIGASVDLELCRGYPLPFDPDDPNTSLVTSVAILDKEPIIVNGQETYDSPASHSSKT
GKVNGMKDARPSSPADVTSNSSHGYPNDTVSLASSIATQPELITVHIVKGPMGFGFTIAD
SPGGGGQRVKQIVDSPRCRGLKEGDLIVEVNKKNVQALTHNQVVDMLVECPKGSEVTLLV
QRGGLPVPKKSPKSQPLERKDSQNSSQHSVSSHRSLHTASPSHSTQVLPEFPPAEAQAPD
QTDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINSTNFGECPIPDYQE
QDIFLWRKETGFGFRILGGNEPGEPIYIGHIVPLGAADTDGRLRSGDELICVDGTPVIGK
SHQLVVQLMQQAAKQGHVNLTVRRKVVFAVPKTENEVPSPASSHHSSNQPASLTEEKRTP
QGSQNSLNTVSSGSGSTSGIGSGGGGGSGVVSTVVQPYDVEIRRGENEGFGFVIVSSVSR
PEAGTTFAGNACVAMPHKIGRIIEGSPADRCGKLKVGDRILAVNGCSITNKSHSDIVNLI
KEAGNTVTLRIIPGDESSNATLLTNAEKIATITTTHTPSQQGTQETRNTTKPKQESQFEF
KAPQATQEQDFYTVELERGAKGFGFSLRGGREYNMDLYVLRLAEDGPAERCGKMRIGDEI
LEINGETTKNMKHSRAIELIKNGGRRVRLFLKRGDGSVPEYDPSSDRHGPPTGPQGVPEV
RAGPDRRQHPSLESSYPPDLHKSSPHGEKRAHARDPKGSREYSRQPNEHHTWNGTSRKPD
SGACRPKDRAPEGRRDAQAERTAAANGPKRRSPEKRREGTRSADNTLERREKHEKRRDVS
PERRRERSPTRRRDGSPSRRRRSLERLLEQRRSPERRRGGSPERRAKSTDRRRARSPERR
RERSLDKRNREDRASHREREEGNLKQDAGRSSRHPTEQRRRAYKECSTDLSI
Download sequence
Identical sequences ENSMMUP00000023043 9544.ENSMMUP00000039584 ENSMMUP00000039584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]