SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023055 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023055
Domain Number 1 Region: 168-300
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-38
Family Third domain of FERM 0.00053
Further Details:      
 
Domain Number 2 Region: 66-170
Classification Level Classification E-value
Superfamily Second domain of FERM 3.66e-33
Family Second domain of FERM 0.00015
Further Details:      
 
Domain Number 3 Region: 2-63
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.23e-20
Family First domain of FERM 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023055   Gene: ENSMMUG00000017515   Transcript: ENSMMUT00000024633
Sequence length 824
Comment pep:known chromosome:MMUL_1:15:26927709:27035036:1 gene:ENSMMUG00000017515 transcript:ENSMMUT00000024633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KHAKGQDLFDQIVYHLDLVETDYFGLQFLDSAQVAHWLDHAKPIKKQMKIGPAYALHFRV
KYYSSEPNNLREEFTRYLFVLQLRHDILSGKLKCPYETAVELAALCLQAELGECELPEHT
PELVSEFRFIPNQTEAMEFDIFQRWKECRGKSPAQAELSYLNKAKWLEMYGVDMHVVRGR
DGCEYSLGLTPTGILIFEGANKIGLFFWPKITKMDFKKSKLTLVVVEDDDQGREQEHTFV
FRLDSARTCKHLWKCAVEHHAFFRLRTPGNSKSNRSDFIRLGSRFRFSGRTEYQATHGSR
LRRTSTFERKPSKRYPSRRHSTFKASNPVIAAQLCSKTNPEVHNYQPQYHPNIHPSQPRW
HPHSPNVSYPLPSPVLSSSDRLPFGIEENGGTPFLTAASGRHHHQHQHQHQHQHHSNYSL
SLTLENKEGPLRSPNSSSKSLTKLSPGTPALFSEAAAHLKKLELETVKAAGPWPPLHINI
NKAEEKKVSEKTLQTPLLPSPVADHVKCNILKAQLENASRVNIQGGKEESMFVNINKKSS
LQDANVRSPIPIRVETAQPAAEKPEIKPPRVRKLTRQYSFDEDDLPPDLAEAVGVTTATT
TNTTTAATQVSVPLPSPKVQNVSSPHKSEGKGQLSPGAKSPSDRGGAFTLEPGDLLMDFT
EATPLAEPASNPHCAHSRCSPPLSLPMKEETTGVCMYPPIKTRLIKTFPADTMNPFPDTF
TTGPQFTADFRDSKLQCCPGPSSPLIPAATLRPLTETVSTVQTIYTPETCFSGSQCGDTP
AGTGERENDEKTIDDRTVKFSPCHLEDGMVPSVRLLSSGFVCSL
Download sequence
Identical sequences ENSMMUP00000023055 9544.ENSMMUP00000023055 ENSMMUP00000023055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]