SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023101 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023101
Domain Number 1 Region: 151-524
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 3.43e-96
Family Phosphonoacetate hydrolase 0.061
Further Details:      
 
Domain Number 2 Region: 608-855
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 2.41e-25
Family DNA/RNA non-specific endonuclease 0.0094
Further Details:      
 
Domain Number 3 Region: 51-99
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000275
Family Somatomedin B domain 0.0031
Further Details:      
 
Domain Number 4 Region: 100-141
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000915
Family Somatomedin B domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023101   Gene: ENSMMUG00000017549   Transcript: ENSMMUT00000024682
Sequence length 874
Comment pep:known chromosome:MMUL_1:4:132136394:132232364:-1 gene:ENSMMUG00000017549 transcript:ENSMMUT00000024682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESMLTLATEQPVKKNTLKKYKIACIVLLALLVIMSLGLGLGLGLRKLEKQGSCRKKCFD
ASFRGLENCRCDVACKDRGDCCWDFEDTCVASTRIWTCNKFRCGETRLEASLCSCSDDCL
QRKDCCADYKSVCQGETSWLEENCDTAQQSQCPEGFDLPPVILFSMDGFRAEYLYTWDTL
MPNINKLKTCGIHSKYMRAMYPTKTFPNHYTIVTGLYPESHGIIDNNMYDVNLNKNFSLS
SEEQNNPAWWHGQPMWLTAMYQGLKAATYFWPGSEVAINGSFPSIYMPYNRSVPYEERIS
TLLKWLDLPKAERPSFYTMYFEEPDSSGHAGGPVSARVIKALQVVDHAFGMLMEGLKQRN
LHNCVNIILLADHGMDQTYCNKMEYMTDYFPRINFYMYEGPAPRIRALNVPHDFFSFNSE
EIVRNLSCRKPDQHFKPYLTPDLPKRLHYAKNVRIDKVHLFVDRQWLAVGSKSNTNCGGG
NHGYNNEFRSMEAIFLAHGPSFKEKTEVEPFENIEVYNLMCDLLRIQPAPNNGTRGSLNH
LLKVPFYEPSHAEEVSKFSVCGFANPLPTDNLSCLCPHLQNSIQLEQVNQMLNLTQEEIT
ATVKVNLPFGRPRVLQKNVDNCLLYHREYVSGFGKAMRMPMWSSYTVPQLGDTSPLPPTV
PDCLRADVRVPPSESQKCSFYLADENITHGFLYPPAINRTSDSQYDALIMSNLVPMYEEF
RKMWDYFHSVLLIKHATERNGVNVVSGPIFDYNYDGHFDAPEEITKHIANTDIPIPTHYF
VVLTSCKNKSHTPENCPGWLDVLPFIIPHRPTNVESCPEGKPEALWVEERFTAHIARVRD
VELLTGLDFYQDKAQPVSEILQLKTYLPTFETTI
Download sequence
Identical sequences G7MQD3
9544.ENSMMUP00000033099 ENSMMUP00000023101 ENSMMUP00000033099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]