SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023124 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023124
Domain Number 1 Region: 328-399
Classification Level Classification E-value
Superfamily C-terminal domain of adenylylcyclase associated protein 0.0000249
Family C-terminal domain of adenylylcyclase associated protein 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023124   Gene: ENSMMUG00000017564   Transcript: ENSMMUT00000024706
Sequence length 557
Comment pep:known chromosome:MMUL_1:2:100089562:100097586:1 gene:ENSMMUG00000017564 transcript:ENSMMUT00000024706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQSSVLLWVKAEPFIVGALQVPPPSKFSLHYLRKISTYVQIRATEGAYPRLYWSTWRHI
ACGKLQLAKDLAWLYFEIFDSLSVKTPEERLEWSEVLSNCLSEEEVEKQRNQLSVDTLQF
LLFLYIQQLNKVSLRTSLIGEEWPSPRSRSQSPDLTEKSNCHNKNWNDYSHQAFVYDHLS
DLLELLLDPEQLTASFHSTHSSLVSREAVVALSFLIEGTISRARKVYPLHELALWQPLHA
DSGFSKISKTFSFYKLETWLRSCLTGNPFGTSACLKSGKKLAWAHQVEGTTKRAKIACNT
HVAPRMHRLVVMSQVYKQTLAKSSDTLVGAHVKIHRCNESFIYLLSPLRSVTIEKCRNSI
FVLGPVGTTLHLHSCDNVKVIAVCHRLSISSTTACVFHILTPTRPLILSGNQTVTFAPFH
THYPMLEDHMARTGLATVPNYWDNPMVVCRENSDTSVFRLLPPCEFYVFIIPFEMEGDTT
EIPGGLPSVYQKALGQREQKIQIWQKTVKEAHLTKDQRKQFQVLVENKFYEWLINTGHRQ
QLDSLVPPAAGSKQAAG
Download sequence
Identical sequences A0A2K5WF23 F6WSC0
9544.ENSMMUP00000023127 ENSMMUP00000023124 ENSMMUP00000023127 NP_001253881.1.72884 XP_005546669.1.63531 XP_005546670.1.63531 XP_005546671.1.63531 XP_014986847.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]