SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023147 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023147
Domain Number 1 Region: 194-252
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.14e-17
Family Erythroid transcription factor GATA-1 0.00057
Further Details:      
 
Domain Number 2 Region: 143-191
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.98e-16
Family Erythroid transcription factor GATA-1 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023147   Gene: ENSMMUG00000017584   Transcript: ENSMMUT00000024731
Sequence length 294
Comment pep:known chromosome:MMUL_1:10:2052324:2062588:1 gene:ENSMMUG00000017584 transcript:ENSMMUT00000024731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYQSLALAASPSQAAYADSGSFLHAPGTGSPMFVPPARVPSMLSYLSGCEPSPQPPELAA
RPSWAQKATADSAYQGALLPREQFAAPLGRPVTTSYPATYPAYVSPDVAPSWTAGPFDGS
VLHGLPGRRPTFVSDFLEEFPGEGRECVNCGALSTPLWRRDGTGHYLCNACGLYHKMNGV
NRPLVRPQKRLSSSRRAGLCCTNCHTTNTTLWRRNSEGEPVCNACGLYMKLHGVPRPLAM
KKESIQTRKRKPKTIAKTRGSSGSTTNASASPSAVPSTDNSAATSKPKPCLTSP
Download sequence
Identical sequences 9544.ENSMMUP00000023147 ENSMMUP00000023147 ENSMMUP00000023147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]