SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023197 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023197
Domain Number 1 Region: 133-282
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-34
Family Pleckstrin-homology domain (PH domain) 0.0000537
Further Details:      
 
Domain Number 2 Region: 50-86
Classification Level Classification E-value
Superfamily WW domain 0.0000000148
Family WW domain 0.0027
Further Details:      
 
Domain Number 3 Region: 5-41
Classification Level Classification E-value
Superfamily WW domain 0.0000000223
Family WW domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023197   Gene: ENSMMUG00000017628   Transcript: ENSMMUT00000024787
Sequence length 1122
Comment pep:known chromosome:MMUL_1:14:54905835:55135487:1 gene:ENSMMUG00000017628 transcript:ENSMMUT00000024787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAATVGRDTLPEHWSYGVCRDGRVFFINDQLRRTTWLHPRTGEPVNSGHMIRSDMPRGW
EEGFTEEGASYFIDHNQQTTAFRHPVTGQFSPENSEFILQEEPNPHMSKQERNQRPSSMV
SETSTAGTASTLEAKPGPKIIKSSNKIHSFGKRDQAIRRNPNVPVVVRGWLHKQDSSGMR
LWKRRWFVLADYCLFYYKDSREEAVLGSIPLPSYVISPVAPEDRISRKYSFKAVHTGMRA
LIYNSSTAGSQAEQSGMRTYYFSADTQEDMNAWVRAMNQAAQVLSRSSLKRDMEKVERQA
VPQANHTESCHECGRVGPGHTRDCSHRGHDDTVNFERQEQEGEQYRSQRDPLEGKRDRSK
ARSPYSPAEEDALFMDLPSGPRGQQAQPQRAEKNGMLPASYGPGEQNGTGGYQRAFPPRT
NPEKHSQRKSNLAQVEHWARAQKGDSRSLPLDQTLPRQGPGQSLSFPENYQTLPRSTRHP
SGGSSPPPRNLPSDYKYAQDRASHLKMSSEERRAHRDGTVWQLYEWQQRQQFRHGSPTAP
ICLGSPEFTDQGRSRSMLEVPRSISVPPSPSDIPPPGPPRVFPPRRPHTPAERVTVKPPD
QRRSVDISLGDSPRKARGHAVKNSSHVDRRSMPSMGYMTHTVSAPSLHGKSADDTYLQLK
KDLEYLDLKMTGRDLLKDRSLKPVKIAESDIDVKLSIFCEQDRILQDLEDKIRALKENKD
QLESVLEVLHRQMEQYRDQPQHLEKIAYQQKLLQEDLVHIRAELSRESTEMENAWNEYLK
LENDVEQLKQTLQEQHRRAFFFQEKSQIQKDLWRIEDVTAGLSANKENFRILVESVKNPE
RKTVPLFPHPPVPSLSTSESKPPPQPSPPTSPVRTPLEVRLFPQLQTYVPYRPHPPQLRK
VTSPLQSPTKTKPKVQEDEAPPRPPLPELYSPEDQPPAVPPLPREATIIRHTSVRGLKRQ
SDERKRDRELGQCVNGDSRVELRSYVSEPELATLSGDMAQPSLGLVGPESRYQTLPGRGL
SGSMSRLQQSSTIAPYVTLRRGLNAESSKATFPRPKSALERLYSGDHQRGKMSAEEQLER
MKRHQKALVRERKRTLGQGERMGLPSSRYLSRPLPGDLGSVC
Download sequence
Identical sequences ENSMMUP00000023197 ENSMMUP00000023197 9544.ENSMMUP00000023197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]