SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023227 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023227
Domain Number 1 Region: 108-183
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000157
Family HLH, helix-loop-helix DNA-binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023227   Gene: ENSMMUG00000017652   Transcript: ENSMMUT00000024817
Sequence length 323
Comment pep:known chromosome:MMUL_1:3:13527077:13530339:-1 gene:ENSMMUG00000017652 transcript:ENSMMUT00000024817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRSAMG
SAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKR
MHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGH
HAGFHPSACGGLAHSAPLPAATAHPAAAAHAAHHPAVHHPILPPAAAAAAAAAAAAAVSS
ASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGGSGGFQHWGGMPCPCSMCQV
PPPHHHVSAMGAGSLPRLTSDAK
Download sequence
Identical sequences A0A0D9SBH0 A9CAZ2 F6UI46 I7G8B3
ENSMMUP00000023227 9544.ENSMMUP00000023227 NP_001271865.1.63531 XP_007962898.1.81039 XP_011724532.1.29376 XP_014988488.1.72884 XP_017739462.1.44346 ENSMMUP00000023227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]