SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023270 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023270
Domain Number 1 Region: 55-338
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 5.14e-82
Family Regulator of chromosome condensation RCC1 0.016
Further Details:      
 
Domain Number 2 Region: 377-482
Classification Level Classification E-value
Superfamily POZ domain 0.00000863
Family BTB/POZ domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023270   Gene: ENSMMUG00000017688   Transcript: ENSMMUT00000024864
Sequence length 547
Comment pep:known chromosome:MMUL_1:17:27281930:27313433:-1 gene:ENSMMUG00000017688 transcript:ENSMMUT00000024864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEELPLFSGDSGKPVQATLSSLKMLDVGKWPIFSLCSEEELQLIRQACVFGSAGNEVLY
TTVNDEIFVLGTNCCGCLGLGDVQSTIEPRRLDSLSGKKIASLSYGSGPHIVLATTEGEV
FTWGHNAYSQLGNGTTNHGLVPCQISTNLSNKQVIEVACGSYHSLVLTSDGEVFAWGYNN
SGQVGSGSTVNQPIPRRVTGCLQNKVVVTIACGQMCCMAVVDTGEVYVWGYNGNGQLGLG
SSGNQPTPCRVAALQGIRVQRVACGYAHTLVLTDEGQVYAWGANSYGQLGTGNKSNQSYP
TPVTVEKDRIIEIAACHSTHTSAAKTQGGHVYMWGQCRGQSVILPHLTHFSCTDDVFACF
ATPAVSWRLLSVEPDDHLTVAESLKREFDNPDTADLKFLVDGKYIYAHKVLLKIRVSQHQ
STQRFTEDYIQNTVRIISEWLSEMLEITPPNKHIFPTGLLDLATFYRENRLKKLCQQTIK
QGICEENAIALLSAAVKYEAQDLEEFCFRFCINHLTVVTQTSGFAEMDHDLLKNFISKAS
RVGAFKN
Download sequence
Identical sequences ENSMMUP00000023270 ENSMMUP00000023270 9544.ENSMMUP00000023270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]