SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023300 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023300
Domain Number 1 Region: 475-802
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 6.19e-62
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000023
Further Details:      
 
Domain Number 2 Region: 808-935
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.62e-19
Family Ricin B-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023300   Gene: ENSMMUG00000017717   Transcript: ENSMMUT00000024900
Sequence length 940
Comment pep:known chromosome:MMUL_1:12:20859898:20913974:1 gene:ENSMMUG00000017717 transcript:ENSMMUT00000024900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRIRKFFRGSGRVLAFIFVASVIWLLFDMAALRLSFNEINTRVIKEDIVRRERIGFRVQ
PDQVKIFYSSIKEMKPPLKGHGKGARGKENFRKTEESVLKVEVDLDQTQRERKMQNALGR
GKVVPLWHPAHLQTLPVPPHKQKTEGRGTNPEASSHQGTPKQMTAQGAPKTSFIAAKGTP
LVKISAHMGRVSLKQEPLKSHSPSSDTSKLAAERDLNVTISLSTDRPKKRSQAVAKERAH
PASTAEPKSGEVMALNKTKSQSKEVNANKHKANTSLPFLKFIVNSNRLRKQSINETHLGS
LSKDDGARGAHGKKLNFSESHVVIITKEEEQKADPKEVSNSKTKTVFPKVLGKSQGKHIS
RNRSEMSFSSLAPHRVPLSQTNHALAGGLKPAKINITAKAPFTEYNQSHTKALLPEDSGM
HQVLRIDVTLSPRDPKAPGQFGRPVVVPHGKEKEAERRWKEGNFNVYLSDLIPVDRAIED
TRPAGCTEQLVHNNLPTTSVIMCFVDEVWSTLLRSVHSVLNRSPPYLIEEILLVDDFSTK
DYLKDNLDKYMSQFPKVRILHLKERHGLIRARLAGAQNATGDVLTFLDSHVECNVGWLEP
LLERVYLSRKKVACPVIEVINDKDMSYMTVDNFQRGIFVWPMNFGWRTIPPDVIAKNRIK
ETDAIKCPVMAGGLFSIDKSYFFELGTYDPGLDVWGGENMELSFKVWMCGGEIEIIPCSR
VGHIFRNDNPYSFPKDRMKTVERNLVRVAEVWLDEYKELFYGHGDHLIDQGLDVGNLTQQ
RELRKKLKCKSFKWYLENVFPDLKAPIVRASGVLINVALGKCISIENTTVILEDCDGSKE
LQQFNYTWLRLIKCGEWCIAPTPDKGGIGLHPCDNRNKELKWLHKSTSVFHPELVNHIVF
ENNQQLLCLEGNFSQKILKVAVCDPVKPYQKWKFEKYYEA
Download sequence
Identical sequences F7F8T7
XP_001087663.1.72884 ENSMMUP00000023300 ENSMMUP00000023300 9544.ENSMMUP00000023300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]