SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023405 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023405
Domain Number 1 Region: 24-143,177-200
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.16e-38
Family Acetylcholinesterase-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023405   Gene: ENSMMUG00000032427   Transcript: ENSMMUT00000025015
Sequence length 206
Comment pep:known chromosome:MMUL_1:X:70055913:70063238:1 gene:ENSMMUG00000032427 transcript:ENSMMUT00000025015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRSLCLTLWFLSLALRASTQAPAPTVNTHFGKLRGARVPLPSEILGPVDQYLGVPYAAPP
IGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHTAVPEVMLPVWFTANLDIVATYIQEPN
EDCLYLNVYVPTEDARSRSASARLKEQRHLCEGGWDNAATQGHSQRGSQGMYLLNIRDSG
AKPVMVYIHGGSYMEGTGNMIDGSVL
Download sequence
Identical sequences G7Q2Z8
9544.ENSMMUP00000023405 ENSMMUP00000023405 ENSMMUP00000023405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]