SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023467 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023467
Domain Number 1 Region: 22-71
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 7.32e-19
Family Cysteine-rich DNA binding domain, (DM domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 243-289
Classification Level Classification E-value
Superfamily UBA-like 0.0000001
Family CUE domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023467   Gene: ENSMMUG00000017848   Transcript: ENSMMUT00000025083
Sequence length 472
Comment pep:known chromosome:MMUL_1:15:76214022:76229272:-1 gene:ENSMMUG00000017848 transcript:ENSMMUT00000025083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGYGSPYLYMGGPVSQPPRAPLQRTPKCARCRNHGVLSWLKGHKRYCRFKDCTCEKCIL
IIERQRVMAAQVALRRQQANESLESLIPDSLRALPGPPPPGDAAAAPQPPPASQQSQPQP
PRPAAELAAAATLRWTAEPQPGALQAQLAKPDLTEERLGDGNPADNTEVFSDKDTDQRSS
PDVAKSKGCFTPESPEIVSVDEGGYAVQKNGGNPESRPDSPKYHVEQNHLLIEGPSGTVS
LPFSLKANRPPLEVLKKIFPNQKPTVLELILKGCGGDLVSAVEVLLSSRSSVTGAERTSA
EPESLVLPSNGHFFEHTLSSYPISSSKWSVGSAFRVPDTLRFSADSSNVVPNPLAVPLQH
PFPQPPRYPLMLRNTLARNQSSPFLPNDVTLWNTMTLQQQYQLRSQYVSPFPSNSTSVFR
SSPVLPARATEDPRISIPDDGCPIVSKQSIYTEDDYDERSDSSDSRILNTSS
Download sequence
Identical sequences ENSMMUP00000023467 XP_001089961.1.72884 9544.ENSMMUP00000023467 ENSMMUP00000023467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]