SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023540 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023540
Domain Number 1 Region: 177-261
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 6.54e-24
Family HSP40/DnaJ peptide-binding domain 0.00026
Further Details:      
 
Domain Number 2 Region: 93-174
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.7e-16
Family HSP40/DnaJ peptide-binding domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023540   Gene: ENSMMUG00000017906   Transcript: ENSMMUT00000025162
Sequence length 270
Comment pep:known chromosome:MMUL_1:19:14228655:14229765:-1 gene:ENSMMUG00000017906 transcript:ENSMMUT00000025162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLKGSGPSGGSGSGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDP
FSGFPMGMGGFTNVNFGRSRPSQEPTRKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRL
NPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRD
GSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEK
RGDLIIEFEVIFPERIPQTSRTVLEQVLPI
Download sequence
Identical sequences ENSMMUP00000023540 ENSMMUP00000023540 9544.ENSMMUP00000023540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]