SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023553 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023553
Domain Number 1 Region: 617-787,959-1039
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.29e-35
Family Carboxylesterase 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023553   Gene: ENSMMUG00000017916   Transcript: ENSMMUT00000025175
Sequence length 1051
Comment pep:known chromosome:MMUL_1:19:48725963:48752719:-1 gene:ENSMMUG00000017916 transcript:ENSMMUT00000025175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGSKSASRPDWQPEPHQRPITTPEPEKTPIAQPESKTQQEPDSRQRPLTQQETPAQHD
AESQKDPRAQQKSASQEEFLAPQKPAPQQSPHIKRVPLTQQEPASQQGPGLGKESTTQQE
PALRERHVAQPGSGPGEPPPVQQEAESTPEAQAKPGAKREPSDPTESTSQETPEQSDQQT
TPVQGAKSKQGSLIELGFLTKLQELSIQRSALEWKALSEWVTDSESESEVGSSSDTESLA
TMGGMVAQGVKLPFKRKSGYKVMSGYGGTSPHKKTSAQNHRHYQDTASKLIYNMDLHTMT
QSLVTLAEDNIAFFSSQGPGETAQRLSGVFAGVREQALGLEPALGRLLGVAHLFDLDPET
PANGYRSLVHTARCCVAHLLHKSRYVASNRRSIFFRTNHNLAELEAYLAALTQLRALVYY
AQRLLVTNQPGVLFFEGDEGLTADFLREYVTLHKGCFYGRCLGFQFTPAIRPFLQTISIG
LVSFGEHYKRNETGLSVAASSLFTSGRFAIDPELRGAEFERIIQNLDVHFWKAFWNITEM
EVLSSLANMTSATVRVSRLLSLPPEAFEMPLTADPTLTVTISPPLAHTGPGPVLVRLISY
DLREGQDSEELSSLVKSNGQRSLELWPRPQQAPRSQSLIVHFHGGGFVAQTSKSHEPYLK
SWAQELGAPIISIDYSLAPEAPFPRALEECFFAYCWAIKHCALLVYPLPNLCLSLPVSKT
AVCWPGAIETILANTMKPHGIMAAYPATMLQPAASPSRLLSLMDPLLPLSVLSKCVSAYA
GAKTEDHSNSDQKALGMIGLVRRDTALLLRDFRLGASSWLNSFLELSGRKSQKMSEPIAE
PMRRSVSEAALAQPQGPLGTDSLKNLTLRDLSQRGNSETLSDTPEMSLSAETLSSSTPSD
VNFLLPPEDAEEEAEAKNKLSPMDRGLGVNAAFPEGFHPRRSSQGATQMPLYSSPVVKNP
FMSPLLAPDSMLKSLPPVHIVACALDPMLDDSVIYARRLRNLGQPVTLRVEDLPHGFLTL
AALCRETRQAAELCVERIRLVLTPPAAPAPA
Download sequence
Identical sequences 9544.ENSMMUP00000023553 ENSMMUP00000023553 ENSMMUP00000023553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]