SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023620 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023620
Domain Number 1 Region: 599-780
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-65
Family SPRY domain 0.00000214
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily DEATH domain 6.24e-24
Family Pyrin domain, PYD 0.0031
Further Details:      
 
Domain Number 3 Region: 371-436
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 8.55e-16
Family B-box zinc-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023620   Gene: ENSMMUG00000017969   Transcript: ENSMMUT00000025247
Sequence length 786
Comment pep:known chromosome:MMUL_1:20:3383718:3397434:-1 gene:ENSMMUG00000017969 transcript:ENSMMUT00000025247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKTPSDHLLSTLEELVPYDFEKFKFKLQNTSVEKEHSRIPRSQIQRARPVKMASLLVTY
YGEEYAVRLTLQVLRAINQRLLAEELHRAAVQEYSTQENGTDDSAASSSLEENKPGSLKT
PDHPEGKEGKEGNGPRSCGDWAASLRYSQPEAGRGLSRKPLSKRREKASESLDVQGKPRT
RSPALPGGRSPGPSPCRAPEPGQAEVLLRRNASSAGRLQGLAGGAPGRKECRLFEVYLPS
GKKRPKSLEFTISTGEKAPPNPETLLTVEETTAANPDSATGAQARPTPDGGASADLEKGP
GNPEHSVTGRPPDKAASPRCHAQEGDPVGDICVRDSCSCPEAASEHPQASGRCSPDCPRC
QASHERKSMGSLSPQPLPQCKPHMKQVQLLFCEDHREPICLICSLSQEHRGHRVRPIEEA
ALEHKKQIQKQLEHLKELRKSGEEQRSYGEGKAVNFLKQTEALKQRMQRKLQQVYHFLEQ
QEHVFMASLENVGHMVGQIRKAYDTRISQDVALLDALIGELETKQCQSEWDFLQDIGDIL
HRAKTVPLPERWTPPQEMKQKIQLLHQKLEFVEKNAKYFLETLRSEMEMFNVPELIGAQA
HAVNVILDAETAYPNLIVSDDLKSVRLGNKRERLPDGPQRFDSCIVVLGSPSFLSGHHYW
EVEVGDKTAWILGACKASISRKGNMTLSPENGYWVVIMMKENEYQASSVPPTRLLIKVPP
KRVGIFVDYRVGSISFYNVTARSCIYTFTSCCFSEPLQPIFSPGTHDGGKNTAPLTICPV
GGQGPD
Download sequence
Identical sequences ENSMMUP00000023620 ENSMMUP00000023620 9544.ENSMMUP00000023620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]