SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023639 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000023639
Domain Number - Region: 93-137
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0811
Family SNARE fusion complex 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023639   Gene: ENSMMUG00000017988   Transcript: ENSMMUT00000025268
Sequence length 270
Comment pep:known chromosome:MMUL_1:17:26855878:26874389:-1 gene:ENSMMUG00000017988 transcript:ENSMMUT00000025268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASSSGEKEKERLGGGLGVASGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAG
EENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQI
LATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDL
EMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDF
LLEPPGHNKENEDDVEIMSTDSSSSSSESD
Download sequence
Identical sequences A0A2K6DEN8 I2CU03
ENSMMUP00000023639 NP_001252711.1.72884 XP_011754858.1.29376 XP_011919711.1.92194 ENSMMUP00000023639 9544.ENSMMUP00000023639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]