SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023769 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023769
Domain Number 1 Region: 649-725
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-19
Family SH3-domain 0.0000335
Further Details:      
 
Domain Number 2 Region: 1615-1698
Classification Level Classification E-value
Superfamily SH3-domain 5.12e-17
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 1753-1814
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000184
Family SH3-domain 0.00092
Further Details:      
 
Domain Number 4 Region: 971-1083
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000896
Family Fibronectin type III 0.00015
Further Details:      
 
Domain Number 5 Region: 885-949
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000108
Family Fibronectin type III 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000023769
Domain Number - Region: 334-519
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00335
Family BAR domain 0.051
Further Details:      
 
Domain Number - Region: 788-871
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0541
Family Fibronectin type III 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023769   Gene: ENSMMUG00000018087   Transcript: ENSMMUT00000025406
Sequence length 1816
Comment pep:known chromosome:MMUL_1:16:42548121:42571382:-1 gene:ENSMMUG00000018087 transcript:ENSMMUT00000025406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQLTTLPRPGNPGAMEPWALPTWQSWTPGRGGEPGDAVPSVADTPPAALQLPELRSEES
SEPKGARSSGPIGGTDPEEAEACLPSLGQQASSSGPACQRPEDEEVEAFPKAKLNMGFGD
RPNLELLRALGELRQRCAILKEENQMLRKSSFPETEEKVRRLKRKNAELAVIAKRLEERA
RKLQETNLRVVSAPLPRPGASLELCRKALARQRARDLSETASALLAKDKQIAALQRECRE
LQARLTLVGKEGPQWLHVRDFDRLLRESQREVLRLQRQIALRNQRETPPRPPSRPPGPAL
PARAEAPAPGAPGEATPQEDADNLPVILGEPEKEQRVQQLESELSKKRKKCESLEQEARK
KQRRCEELELQLREAQNENARLVEENSRLSGRVTEKEQVEWENAELRGQLLGVTQERDSA
LRKSQGLQSKLESLEQVLKHMREVAQRRQQLEVEHEQARLSLREKQEEVRRLQQAQAEAK
KEHEGAVQLLESTLDSMQARVRELEEQCRSQTEQFSLLAQELQAFRLHPGPLDLLTSALD
CGTLGDRPPPPCCCSTPRPCRGSGPKDLDLPPGSPGRCTPKSSEPAPATLTGVPRRTAKK
AESLSNSSHSESIHNSPKSCPTPEVDTASEVEELEADSVSLLPATPEGSRGGARIQVFLA
RYSYNPFEGPNENPEAELPLTAGEYIYVYGNMDEDGFFEGELMDGRRGLVPSNFVERVSD
DDLLTSLPPELADLSHSSGPELSFLSVGGGGSSSGGQSSGGRSQPRPEEEDAGDDLSVSP
SPEGLGEPPAVPYPRCLVVLKQLAHSVVLAWEPPPERVELHGFHICVNGELRQALGPGAP
PKAVLENLDLRAGPLHISVQALTSRGSSDPLRCCLAVGARAGVVPSQLRVHRLTATSAEI
TWVPGNSNLAHAIYLNGEECPPASPSTYWATFCHLRPGTPYQAQVEAQLPPQGPWEPGWE
RLEQRAATLQFTTLPAGPPDAPLDVQIEPGPSPGILIISWLPVTIDAAGTSNGVRVTGYA
IYADGQKIMEVASPTAGSVLVELSQLQLLQVCREVVVRTMSPHGESADSIPAPITPALAP
ASLPARVSCPSPRPSPEARAPLASASPAPGDPSSPLQHPAPLGTQEPPGAPPASPSREMP
KGSHEDPPAPCSQEEAGAAVLGTSEERTASTSTLGEKDPSPAAPSLAKQEAEWTAGEACP
APSSAQGALAQQAPNTEACQGGDPGSGLRPRAEKEDAAELGVHLVNSLVDHGRNSDLSDI
QEEEEEEEEEEEEEELGSRTCSFQKQVAGNSIRENGAKSQPDPFCETDSDEEILEQILEL
PLQQFCSKKLFSIPEEEEEEEEDEEKEKPGAGCSSQDPGPPEPALLGLGCDSGQPRRPGQ
CPLSPEPSRAGDCLEDMPGLVGGSSRRRGGGSPEKPPSRRRPPDPREHCSRLLSNNGPQA
SGRPGPTRERGGLPVIEGPRTGLEASGRGRLGPSRRCSRGWALEPGLASCLSPKCLEISI
EYDSEEEQEAGSGGISITSSCYPGDGEAWGTATVGRPRGPPKANSGPKPYPPLPAWEKGE
PEQRGRSATGRAKEPLSRATETREARGQDSSGRRGPQKRGARVPRPSTAELVPVRSPSEA
LAYQHLPVRIFVALFDYDPVSMSPNPDAGEEELPFREGQILKVFGDKDADGFYRGEGGGR
TGYIPCNMVAEVAVDSPAGRQQLLQRGYLSPDILLEGSGNGPFVYSTARTTGPPPKPRRS
KKAESEGPAQPCPGPPKLVPSAELKTPHSMVAAFDYNPQESSPNMDVEAELPFRAGDVIT
VFGGMDDDGFYYGELN
Download sequence
Identical sequences ENSMMUP00000023769 9544.ENSMMUP00000023769 ENSMMUP00000023769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]