SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023832 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023832
Domain Number 1 Region: 314-427
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.82e-30
Family Reprolysin-like 0.0078
Further Details:      
 
Domain Number 2 Region: 518-574
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000889
Family TSP-1 type 1 repeat 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023832   Gene: ENSMMUG00000018132   Transcript: ENSMMUT00000025474
Sequence length 837
Comment pep:known chromosome:MMUL_1:1:139801174:139808450:-1 gene:ENSMMUG00000018132 transcript:ENSMMUT00000025474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQTGAHPGRGLAGRWLWGAQPCLLLPIVPLSWLVWLLLLLLASLLPSAWLASPLPREEE
IVFPEKLNGSVLPGSGAPARLLCRLQAFGETLLLELEQDSGVQVEGLTVQYLGQAPELLG
GAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHI
LRRKSPASGQGPMCNVKAPPGSPSPRPRRAKVGSPGPPFLVRLRPLPFTLLLARPTEGSQ
RWVRDSGLGITAPPPHPTPSWPWHLLLAQHVAAQPSSPGPIGPSHTQAWRTPKCLLTAVQ
AALTSGAPAALGSILFTRQDLCGVSTCDTLGMADVGTVCDPARSCAIVEDDGLQSAFTAA
HELGHVFNMLHDNSKPCISLNGPLSTSRHVMAPVMAHVDPEEPWSPCSARFITDFLDNGY
GHCLLDKPEAPLHLPVTFPGKDYDADRQCQLTFGPDSRHCPQLPPPCAALWCSGHLNGHA
MCQTKHSPWADGTPCGPAQACMGGRCLHMDQLQDFNTPQAGGWGPWGPWGDCSRTCGGGV
QFSSRDCTRPVPRNGGKYCEGRRTRFRSCNTEDCPTGSALTFREEQCAAYNHRTDLFKSF
PGPMDWVPRYTGVAPQDQCKLTCQARALGYYYVLEPRVVDGTPCSPDSSSVCVQGRCIHA
GCDRIIGSKKKFDKCMVCGGDGSGCSKQSGSFKKFRYGYNSVVTIPAGATHILVRQQGNP
GHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQP
LTLQVLVAGNPQDARLRYSFFVPRPTPSTPRPTPQDWLHRRAQILEILRRRPWAGRK
Download sequence
Identical sequences ENSMMUP00000023832 ENSMMUP00000023832 9544.ENSMMUP00000023832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]