SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023879 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023879
Domain Number 1 Region: 12-218
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.14e-38
Family Regulator of chromosome condensation RCC1 0.0049
Further Details:      
 
Domain Number 2 Region: 519-687
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.96e-28
Family beta-lactamase inhibitor protein-II, BLIP-II 0.066
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000023879
Domain Number - Region: 695-776
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0451
Family DBL homology domain (DH-domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023879   Gene: ENSMMUG00000018155   Transcript: ENSMMUT00000025522
Sequence length 812
Comment pep:known chromosome:MMUL_1:12:65542780:65583148:-1 gene:ENSMMUG00000018155 transcript:ENSMMUT00000025522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSKKRSSTEAEGSKERGLVHIWQAGSFPITPERLPGWGGKTVLQAALGVKHGVLLTEDG
EVYSFGTLPWRSGPAEICPSSPILENALVGQYVVTVATGSFHSGAVTDNGVAYMWGENSA
GQCAVANQQYVPEPNPVSIADSEASPLLAVRILQLACGEEHTLALSISREIWAWGTGCQL
GLITTAFPVTKPQKVEHLAGRVVLQVACGAFHSLALVQCLPSQDLKPVPERCNQCSQLLI
TMTDKEDHVIISDSHCCPLGVTLTESQAENHPSTALSPSTETLDRQEEVFENTLVASDQS
VATELNAVSAQTTSSDAVSSQQNVMGTTEISSARNVPSYSDTQAVSEYLRKLSDHSVRED
SEHGEKPVPSQPLIEEAIPNLHSPPTTSTSALNSLVVSCASAVGVRVAATYEAGALSLKK
VMNFYSTTPCETGAQAGSSAIGPEGLKDSREEQVKQESMQGKKSSSLVDIREEETEGSSR
RLSLPGLLSQVSPRLLRKAARVKTRTVVLTPTYSGEADALLPSLRTEVWTWGKGKEGQLG
HGDVLPRLQPLCVKCLDGKEVIHLEAGGYHSLALTAKSQVYSWGSNTFGQLGHSDFPTTV
PRLAKISSENGVWSVAAGQDYSLFLVDTEDFQPGLYYSGRQDPTEGDNLPENHSGSKTPV
LLSCSKLGYISRVTAGKDSYLALVDKNIMGYIASLHELATTERRFYSKLSDIKSQILRPL
LSLENLGTTTTVQLLQEVASRFSKLCYLIGQHGASLSSFLHGVKEARSLVILKHASLFLD
SYTEQVSSPVSCSISAGLFCQGEQLLNQKRLD
Download sequence
Identical sequences ENSMMUP00000023879 9544.ENSMMUP00000023879 ENSMMUP00000023879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]