SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023896 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000023896
Domain Number - Region: 137-242
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0738
Family Atu1826-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023896   Gene: ENSMMUG00000018173   Transcript: ENSMMUT00000025540
Sequence length 378
Comment pep:known chromosome:MMUL_1:14:75220131:75221285:1 gene:ENSMMUG00000018173 transcript:ENSMMUT00000025540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFPCRRSLTPKTLACLLVGVSFLALQQWFLQAPRSPREERSQQEETPEGPTDAPLALTP
GPPCVANASANATANFEQLPARIQDFLRYRHCRHFPLLWDAPAKCASRRGVFLLLAVKSA
PAHYERRELIRRTWGQERSYGEWPVRRLFLLGTPGPEDEARAERLAELVALEAREHGDVL
QWSFADTFLNLTLKHLHLLDWLAARCPHARFLLSGDDDVFVHTANVVRFLQAQPPGRHLF
TGQLMEGSVPIRDSWSKYFVPPQLFPGSAYPVYCSGGGFLLSSLTARALRAAALHTPLLP
IDDAYMGMCLERAGLAPSGHEGIRPYGVQLPGAQQSSFDPCMYRELLLVHRFAPYEMLLM
WKALHSPTLSCDRGHRVS
Download sequence
Identical sequences F7EYE7
ENSMMUP00000023896 ENSMMUP00000023896 9544.ENSMMUP00000023896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]