SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023910 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023910
Domain Number 1 Region: 287-556
Classification Level Classification E-value
Superfamily Kelch motif 9.29e-65
Family Kelch motif 0.0000586
Further Details:      
 
Domain Number 2 Region: 12-131
Classification Level Classification E-value
Superfamily POZ domain 3.22e-33
Family BTB/POZ domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023910   Gene: ENSMMUG00000018181   Transcript: ENSMMUT00000025554
Sequence length 597
Comment pep:known chromosome:MMUL_1:1:9615701:9623381:-1 gene:ENSMMUG00000018181 transcript:ENSMMUT00000025554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPAPLAVLPFSDPAHALSLLRGLSQLRAERKFLDVTLEAAGGRDFPAHRAVLAAASPY
FRAMFAGQLRESRAERVRLHGVPPDMLQLLLDFSYTGRVAVSGDNAEPLLRAADLLQFPA
VKEACGAFLQQQLDLANCLDMQDFAEAFSCSGLASAAQRFILRHVGELGAEQLERLPLAR
LLRYLRDDGLCVPKEEAAYQLALRWVRADPPRRAAHWPQLLEAVRLPFVRRFYLLAHVEA
EPLVARCPPCLRLLREARDFQAARYDRHDRGPCPRMRPRPSTGLAEILVLVGGCDQDCDE
LVTVDCYNPQTGQWRYLAEFPDHLGGGYSIVALGNDIYVTGGSDGSRLYDCVWRYNSSVN
EWAEVAPMLKAREYHSSSVLDGLLYVVAADSTERYDHTTDSWEALQPMTYPMDNCSTTAC
RGRLYAIGSLAGKETMVMQCYDPDTDLWSLVDCGQLPPWSFAPKTVTLNGLMYFVRDDSA
EVDVYNPTKNEWDKIPSMNQVHVGGSLAVLGGKLYVSGGYDNTFELSDVVEAYDPETRAW
SVVGRLPEPTFWHGSVSIFRQFMPQTFSGGRGFELDSGSNDMDPGRPRPPRDPDELH
Download sequence
Identical sequences A0A2K5NK34 A0A2K5VPF9
ENSMMUP00000023910 ENSMMUP00000040638 9544.ENSMMUP00000040638 XP_001094118.1.72884 XP_005544964.1.63531 XP_011904929.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]