SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023917 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023917
Domain Number 1 Region: 40-797
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.91e-277
Family Motor proteins 0.000000000129
Further Details:      
 
Domain Number 2 Region: 1985-2101
Classification Level Classification E-value
Superfamily Second domain of FERM 1.1e-22
Family Second domain of FERM 0.0024
Further Details:      
 
Domain Number 3 Region: 1253-1356
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.12e-20
Family First domain of FERM 0.033
Further Details:      
 
Domain Number 4 Region: 2102-2192
Classification Level Classification E-value
Superfamily PH domain-like 2.73e-20
Family Third domain of FERM 0.015
Further Details:      
 
Domain Number 5 Region: 1885-1993
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000142
Family First domain of FERM 0.088
Further Details:      
 
Domain Number 6 Region: 1348-1442
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000000379
Family Second domain of FERM 0.0076
Further Details:      
 
Domain Number 7 Region: 1607-1677
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000159
Family SH3-domain 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000023917
Domain Number - Region: 795-864
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000129
Family Motor proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023917   Gene: ENSMMUG00000018178   Transcript: ENSMMUT00000025561
Sequence length 2206
Comment pep:known chromosome:MMUL_1:14:75322895:75394171:1 gene:ENSMMUG00000018178 transcript:ENSMMUT00000025561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALLQKGDYVWMDLRSGQEFDVPIGAVVKLCDSGQIQVVDDEGNEHWISPQNATHIKPMHP
TSVHGVEDMIRLGDLNEAGILRNLLIRYRDHLIYTYTGSILVAVNPYQLLSIYSPEHIRQ
YTNKKIGEMPPHIFAIADNCYFNMKRNSRDQCCIISGESGAGKTESTKLILQFLAAISGQ
HSWIEQQVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSR
SRVCRQAPDERNYHVFYCMLEGMSEDQKKKLGLGQASDYNYLAMGNCITCEGRVDSQEYA
NIRSAMKVLMFTDTENWEISKLLAAILHLGNLQYEARTFENLDACEVLFSPSLATAASLL
EVNPPDVMSCLTSRTLITRGETVSTPLSREQALDVRDAFVKGIYGRLFVWIVDKINAAIY
KPPSQDVKNSRRSIGLLDIFGFENFAVNSFEQLCINFANEHLQQFFVRHVFKLEQEEYDL
ESIDWLHIEFTDNQDALDMIANKPMNIISLIDEESKFPKGTDTTMLHKLNSQHKLNANYI
PPKNNHETQFGINHFAGVVYYETQGFLEKNRDTLHGDIIQLVHSSRNKFIKQIFQADVAM
GAETRKRSPTLSSQFKRSLELLMRTLGACQPFFVRCIKPNEFKKPMLFDRHLCVRQLRYS
GMMETIRIRRAGYPIRYSFVEFVERYRVLLPGVKPAYKQGDLRGTCQRMAETVLGTHDDW
QIGKTKIFLKDHHDMLLEVERDKAITDRVILLQKVIRGFKDRSNFLKLKNAATLIQRHWR
GHNCRKNYGLMRLGFLRLQALHRSRKLHQQYRLARQRIIQFQARCRAYLVRKAFRHRLWA
VLTVQAYARGMIARRLHQRLRAEYLRRLEAEKMRLAEEEKLRKEMSAKKAKEEAERKHQE
RLAQLAREDAERELKEKEAARRKKELLEQMERARHEPVNHSDMVDKMFGFLGTSGGLPGQ
EGQAPSGFEDLERGRREMVEEDLDAALPLPDEDEEDLSEYKFAKFAATYFQGTTTHSYTR
RPLKQPLLYHDDEGDQLAALAVWITILRFMGDLPEPKYHTAMSDGSEKIPVMTKIYETLG
KKTYKRELQALQGEGEAQLPEGQKRSSVRHKLVHLTLKKKSKLTEEVTKRLHDGESTVQG
NSMLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILVSLCV
GCFAPSEKFVKYLRNFIHGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIM
LPVTFMDGTTKTLLTDSATTAKELCNALADKISLKDRFGFSLYIALFDKVSSLGSGSDHV
MDAISQCEQYAKEQGAQERNAPWRLFFRKEVFTPWHSPSEDNVATNLIYQQVVRGVKFGE
YRCEKEDDLAELASQQYFVDYGSEMILERLLNLVPTYIPDREITPLKTLEKWAQLAIAAH
KKGIYAQRRTDAQKVKEDVVNYARFKWPLLFSRFYEAYKFSGPSLPKNDVIVAVNWTGVY
FVDEQEQVLLELSFPEIMAVSSSRECRVWLSLGCSDLGCAAPHSGWAGLTPAGPCSPCWS
CRGAKTTAPSFTLATIKGDEYTFTSSNAEDIRDLVVTFLEGLRKRSKYVVALQDNPNPAG
EESGFLSFAKGDLIILDHDTGEQVMNSGWANGINERTKQRGDFPTDCVYVMPTVTMPPRE
IVALVTMTPDPRQDVVRLLQLRTAEPEVRAKPYTLEEFSYDYFPRWLLGKDGSHRARSCR
LPLPSGCVLGILLSQLQVMQALWGSPPVLKYMGDYPSKRTRSVNELTDQIFEGPLKAEPL
KDEAYVQILKQLTDNHIRYSEERGWELLWLCTGLFPPSNILLPHVQRFLQSRKHCPLAID
CLQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCQ
NIATRLLLKSSEGFSLFVKIADKVISVPENDFFFDFVRHLTDWIKKARPIKDGIVPSLTY
QVFFMKKLWTTTVPGKDPMADSIFHYYQELPKYLRGYHKCTREEVLQLGALIYRVKFEED
KSYFPSIPKLLRELVPQDLIRQVSPDDWKRSIVAYFNKHAGKSKEEAKLAFLKLIFKWPT
FGSAFFEVKQTTEPNFPEILLIAINKYGVSLIDPRTKDILTTHPFTKISNWSSGNTYFHI
TIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSKQRGSRSGK
Download sequence
Identical sequences ENSMMUP00000023917 9544.ENSMMUP00000023917 ENSMMUP00000023917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]