SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023941 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023941
Domain Number 1 Region: 528-752
Classification Level Classification E-value
Superfamily GFP-like 3.14e-85
Family Domain G2 of nidogen-1 0.000000514
Further Details:      
 
Domain Number 2 Region: 1108-1364
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-42
Family YWTD domain 0.0000000901
Further Details:      
 
Domain Number 3 Region: 902-1009
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.7e-22
Family Thyroglobulin type-1 domain 0.00044
Further Details:      
 
Domain Number 4 Region: 1015-1085
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.31e-19
Family Thyroglobulin type-1 domain 0.001
Further Details:      
 
Domain Number 5 Region: 484-525,763-860
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.34e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 6 Region: 852-904
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000492
Family EGF-like domain of nidogen-1 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023941   Gene: ENSMMUG00000018201   Transcript: ENSMMUT00000025588
Sequence length 1376
Comment pep:known chromosome:MMUL_1:7:115025034:115087366:-1 gene:ENSMMUG00000018201 transcript:ENSMMUT00000025588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGDRVAGRPVLSPLPVLLLLPLLLSRAAALHPDELFPYGESWGDQLLQEGDDESSAVVK
LANPLHFYEARFSNLYVGTNGIISTQDFPRETQYVDYDFPTDFPAIAPFLADIDTSHGRG
RVLYREDTSPAVLGLAARYVRAGFPRSAHFTPTHAFLATWEQVGAYEEVKRGALPSGELN
TFQAVLASDGSDSYALFLYPANGLQFLGTRPKESYNVQLQLPARVGFCRGEADDLKSEGP
YFSLTSTEQSVKNLYQLSNLGIPGVWAFHIGSTSLLDNVRPAAVGGDLSTARSSVPLGRS
FSHATALESDYNEDNLDYYDVNEEEAEYLPGEPEEALNGHSSIDVSFQSKVDTKPLEESA
TLDPHTKEGTSLGEVEGPDLKGQVESWDERGTRSPAPPEVDRDSLAPSWETPPPYPENRS
IQPYPDGGPVPSEMDVPPAHPEEEIVLRNYPASGHTTPLSRGTYEVGLEDNIGSNTEVFT
YNAANKETCEHNHRQCSRHAFCTDYATGFCCHCQSKFYGNGKHCLPEGAPHRVNGKVSGH
LRVGHTPVHFTDVDLHAYVVGNDGRAYTAISHIPQPAAQALLPLTPIGGLFGWLFALEKP
GSENGFSLAGAAFTHDMEVTFYPGEERVHITQTAEGLDPENYLSIKTNIQGQVPYIPANF
TAHISPYKELYHYSDSTVTTTSSRDYSLTFGAINQTWSYRIHQNITYQVCRHAPRRPAFP
TTQQLSVDRVFALYNDEERVLRFAVTNQIGPVEEDSDPTPVNPCYDGSHMCDTTARCHPG
TGVDYTCECASGYQGDGRNCVDENECATGFHRCGPNSVCINLPGTYRCECRSGYEFADDR
HTCILITPPPNPCEDGSHTCAPAGQARCVHHGGSAFSCACLPGYAGDGHQCTDIDECSEN
RCHPAATCYNTPGSFSCRCQPGYYGDGFQCIPDSTSSLTPCEEQQRHAQAQYAHPGARFH
IPQCDEQGNFLPLQCHGSTGFCWCVDPDGHEVPGTQTPPGSTPPHCGPPPEPTQRPPTIC
ERWRENLLEHYGGTPRDDQYVPQCDDLGHFTPLQCHGKSDFCWCVDKDGREVQGTRSQPG
TTPACIPTVAPPMVRPTPRPDVTPPSVGTFLLYTQGQQIGYLPLNGTRLQKDAAKTLLSL
HGSIIVGIDYDCRERMVYWTDVAGRTISRASLELGAEPETIVNSGLISPEGLAIDHIRRT
MYWTDSVMDKIESALLDGSERKVLFHTDLVNPRAIAVDPIRGNLYWTDWNREAPKIETSS
LDGENRRILINTDIGLPNGLTFDPFSKLLCWADAGTKKLECTLPDGTGRRVIHNNLKYPF
SIVSYADHFYHTDWRRDGVVSVNKHSGQFTDEYLPEQRSHLYGITAVYPYCPTGKK
Download sequence
Identical sequences 9544.ENSMMUP00000023941 ENSMMUP00000023941 ENSMMUP00000023941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]