SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023982 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000023982
Domain Number - Region: 82-121
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00168
Family Chromo domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023982   Gene: ENSMMUG00000018243   Transcript: ENSMMUT00000025635
Sequence length 274
Comment pep:known chromosome:MMUL_1:1:18864801:18870173:-1 gene:ENSMMUG00000018243 transcript:ENSMMUT00000025635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLFTSAHKDCPMPQGTDPLNPDLPSGRTPTMAVDPVTGKDKQMDFCWDPWQRCFQTTNGY
LSDSRSCPSNYNVAALATSSLVGVVQSIKDHITKPTAMARGRVAHLIEWKGWSAQRAGWE
LSPAEDEHYCCLPDELREARFAAGVAEQFAITEATLSAWSSLDDEELYPENSPQGIFQLQ
DLESIYLQDSLPSGPSQDDSLQAFSSPSLSPESCPSLEEPPSTAGIPQPPSPELQHQRRR
PGHQGPEGGTHLPGSLPSMDSSSLWEEEDEVFYN
Download sequence
Identical sequences ENSMMUP00000023982 9544.ENSMMUP00000023982 ENSMMUP00000023982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]