SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000023985 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000023985
Domain Number 1 Region: 603-907
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.06e-82
Family Protein kinases, catalytic subunit 0.00000000012
Further Details:      
 
Domain Number 2 Region: 31-199
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-65
Family Ephrin receptor ligand binding domain 0.00000998
Further Details:      
 
Domain Number 3 Region: 328-529
Classification Level Classification E-value
Superfamily Fibronectin type III 8.88e-31
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 4 Region: 895-965
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.8e-19
Family SAM (sterile alpha motif) domain 0.00096
Further Details:      
 
Domain Number 5 Region: 259-330,366-382
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000262
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000023985   Gene: ENSMMUG00000018245   Transcript: ENSMMUT00000025638
Sequence length 974
Comment pep:known chromosome:MMUL_1:1:18929701:18959874:-1 gene:ENSMMUG00000018245 transcript:ENSMMUT00000025638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWAARACFVLLWGCALAPATAAQGKEGDLWDLASSGGELGWLTHPYGKGWDLMQNIMN
DMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFN
LYYAESDLDYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGFYL
AFQDIGACVALLSVRVYYKKCPELLQSLARFPETIAGSDAPSLATVAGTCVDHAVVPPGG
EEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEVSESPCLECPEHTLPS
PEGATSCECEEGFFRAPQDPMSMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDI
VYSVTCEQCWPESGECGPCESSVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSG
LVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSN
SYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLCDPESGAWAATAG
TGLHLTDLPAFGSLWGCFRRKNLRARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQAVL
KFTTEIHPSCVTRQKVIGAGEFGEVYKGTLKTSSGKKEVPVAIKTLKAGYTEKQRVDFLG
EAGIMGQFSHHNIIRLEGVVSKYKPMMIITEFMENGALDKFLREKDGEFSVLQLVGMLRG
IAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKIPIR
WTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDC
PSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSGSE
GVPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAYSL
LGLKDQVNTVGIPI
Download sequence
Identical sequences ENSMMUP00000023985 9544.ENSMMUP00000023985 ENSMMUP00000023985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]