SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024004 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024004
Domain Number 1 Region: 249-500
Classification Level Classification E-value
Superfamily Kelch motif 5.17e-35
Family Kelch motif 0.011
Further Details:      
 
Domain Number 2 Region: 430-630
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 2.48e-18
Family Galactose oxidase, central domain 0.033
Further Details:      
 
Domain Number 3 Region: 17-156
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.45e-17
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024004   Gene: ENSMMUG00000018259   Transcript: ENSMMUT00000025659
Sequence length 737
Comment pep:known chromosome:MMUL_1:3:168709857:168867362:1 gene:ENSMMUG00000018259 transcript:ENSMMUT00000025659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGGAVAAAPECRLLPYALHKWSSFSSTYLPENILVDKPNDQSSRWSSESNYPPQYLIL
KLERPAIVQNITFGKYEKTHVCNLKKFKVFGGMNEENMTELLSSGLKNDYNKETFTLKHK
IDEQMFPCRFIKIVPLLSWGPSFNFSIWYVELSGIDDPDVVQPCLNWYSKYREQEAIRLC
LKHFRQHNYTEAFESLQKKTKIALEHPMLTDIHDKLVLKGDFDACEELIEKAVNDGLFNQ
YISQQEYKPRWSQIIPKSTKGDGEDNRPGMRGGHQMVIDVQTETVYLFGGWDGTQDLADF
WAYSVKENQWTCISRDTEKEASNGPSARSCHKMCIDIQRRQIYTLGRYLDSSVRNSKSLK
SDFYRYDIDTNTWMLLSEDTAADGGPKLVFDHQMCMDSEKHMIYTFGGRILTCNGSVDDS
RASEPQFSGLFAFNCQCQTWKLLREDSCNAGPEDIQSRIGHCMLFHSKNRCLYVFGGQRS
KTYLNDFFSYDVDSDHVDIISDGTKKDSGMVPMTGFTQRATIDPELNEIHVLSGLSKDKE
KREENVRNSFWIYDIVRNSWSCVYKNDQAAKDNPTKSLQEEEPCPRFAHQLVYDELHKVH
YLFGGNPGKSCSPKMRLDDFWSLKLCRPSKDYLLRHCKYLIRKHRFEEKAQMDPLSALKY
LQNDLYITVDHSDPEETKEFQLLASALFKSGSDFTALGFSDVDHTYAQRTQLFDTLVNFF
PDSMTPPKGNLVDLITL
Download sequence
Identical sequences G7MME1
ENSMMUP00000024004 9544.ENSMMUP00000024003 ENSMMUP00000024003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]