SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024109 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000024109
Domain Number - Region: 48-95
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.0983
Family Bacterial exopeptidase dimerisation domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024109   Gene: ENSMMUG00000018337   Transcript: ENSMMUT00000025770
Sequence length 102
Comment pep:known chromosome:MMUL_1:10:67460571:67460879:-1 gene:ENSMMUG00000018337 transcript:ENSMMUT00000025770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKRHSEGYDMPRPWSALRSHRQHHRPHLHPVLRRPTLTDVEGCLQCLDVRGHSGHAVDA
HLLHASALDLLHALAYDVGHLGPLSPMEGGNVLNVLTALLGP
Download sequence
Identical sequences F7H888
ENSMMUP00000024109 ENSMMUP00000024109 9544.ENSMMUP00000024109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]