SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024111 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024111
Domain Number 1 Region: 2-270
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.14e-66
Family Regulator of chromosome condensation RCC1 0.000000000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024111   Gene: ENSMMUG00000018338   Transcript: ENSMMUT00000025772
Sequence length 273
Comment pep:known chromosome:MMUL_1:1:31261481:31264440:1 gene:ENSMMUG00000018338 transcript:ENSMMUT00000025772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTAGGDLYTLGCGEQGQLGRV
PELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAIHEGHVYGFGLST
YHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGL
GEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSP
VEMTGKQLENRVVLSVSSGGQHTVLLVKDKEQS
Download sequence
Identical sequences 9544.ENSMMUP00000024111 ENSMMUP00000024111 ENSMMUP00000024111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]