SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024151 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024151
Domain Number 1 Region: 5-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.13e-71
Family BAR domain 0.0035
Further Details:      
 
Domain Number 2 Region: 389-564
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.00000207
Further Details:      
 
Domain Number 3 Region: 263-364
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-16
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024151   Gene: ENSMMUG00000018366   Transcript: ENSMMUT00000025812
Sequence length 802
Comment pep:known chromosome:MMUL_1:X:67021986:67393168:-1 gene:ENSMMUG00000018366 transcript:ENSMMUT00000025812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHPPLEFSDCYLDSPDFRERLKCYEQELERTNKFIKDVIKDGNALISAMRNYSSAVQKF
SQTLQSFQFDFIGDTLTDDEINIAESFKEFAELLNEVENERMMMVHNASDLLIKPLENFR
KEQIGFTKERKKKFEKDGERFYSLLDRHLHLSSKKKESQLQEADLQVDKERHNFFESSLD
YVYQIQEVQESKKFNIVEPVLAFLHSLFISNSLTVELTQDFLPYKQQLQLSLQNTRNHFS
STREEMEELKKRMKEAPQTCKLPGQPTIEGYLYTQEKWALGISWVKYYCQYEKETKTLTM
TPMEQKPGAKQGPLDLTLKYCVRRKTESIDKRFCFDIETNERPGTITLQALSEANRRLWM
EAMDGKEPIYHSPITKQQEMELNEVGFKFVRKCINIIETKGIKTEGLYRTVGSNIQVQKL
LNAFFDPKCPGDVDFHNSDWDIKTITSSLKFYLRNLSEPVMTYRLHKELVSAAKSDNLDY
RLGAIHSLVYKLPEKNREMLELLIRHLVNVCEHSKENLMTPSNMGVIFGPTLMRAQEDTV
AAMMNIKFQNIVVEILIEHFGKIYLGPPEESAAPPVPPPRVTARRHKPITISKRLLRERT
VFYTSSLDESEDEIQHQTPNGTITGSIETPKPPQHPKLPIQRSGETDPGRKSPSRPISDG
KLEPCPEVDVGKLVSRLQDGGTKITPKATNGPMPGSGPTKTPSFHIKRPAPRPLAHHKEG
DADSFSKVRPPGEKPTIIRPPVRPPDPPCRAATPQKPEPKPDIVAGNAGEITSSVVASRT
RFFETASRKTGSSQGRLPGDES
Download sequence
Identical sequences A0A2I3LWS9 A0A2K5LCN7 A0A2K5WVZ9 A0A2K6BSZ0 F7H3I5
9544.ENSMMUP00000024151 ENSMMUP00000024151 ENSMMUP00000024151 NP_001248282.1.72884 XP_005593868.1.63531 XP_011731141.1.29376 XP_011731142.1.29376 XP_011916271.1.92194 XP_011916272.1.92194 XP_011916273.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]