SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024164 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024164
Domain Number 1 Region: 335-631
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.13e-90
Family Protein kinases, catalytic subunit 0.000000019
Further Details:      
 
Domain Number 2 Region: 157-284
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.3e-36
Family Synaptotagmin-like (S variant) 0.00000106
Further Details:      
 
Domain Number 3 Region: 25-87
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.84e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0027
Further Details:      
 
Domain Number 4 Region: 99-154
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.89e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024164   Gene: ENSMMUG00000018378   Transcript: ENSMMUT00000025827
Sequence length 672
Comment pep:known chromosome:MMUL_1:16:61686183:62166061:1 gene:ENSMMUG00000018378 transcript:ENSMMUT00000025827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADVFPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
Download sequence
Identical sequences A0A096NTX9 A0A2K5LMT6 A0A2K5UKX2 A0A2K6CYI9 A0A2K6RMH9 H9EMT3
ENSMMUP00000024164 ENSMMUP00000024164 9544.ENSMMUP00000024164 NP_001247662.1.72884 XP_005584797.1.63531 XP_008010230.1.81039 XP_010378287.1.97406 XP_011717851.1.29376 XP_011944883.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]