SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024184 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024184
Domain Number 1 Region: 47-139
Classification Level Classification E-value
Superfamily Immunoglobulin 7.57e-19
Family I set domains 0.0086
Further Details:      
 
Domain Number 2 Region: 167-249
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000109
Family I set domains 0.0096
Further Details:      
 
Domain Number 3 Region: 301-368
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000068
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 4 Region: 247-306
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000249
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000024184
Domain Number - Region: 3-33
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000228
Family I set domains 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024184   Gene: ENSMMUG00000018393   Transcript: ENSMMUT00000025847
Sequence length 370
Comment pep:known chromosome:MMUL_1:15:58072044:58165260:-1 gene:ENSMMUG00000018393 transcript:ENSMMUT00000025847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVEADVGFYTCNATNALGYDSVSIAVTLAGKPLVKTSRMTVINTEKPAVTVDIGSTIKTV
QGVNVTINCQVAGVPEAEVTWFRNKSKLGSPHHLHEGSLLLTNVSSSDQGLYSCRAANLH
GELTESTQLLILDPPQVPTQLEDIRALLAATGPNLPSVLTSPLGTQLVLDPGNSVLLGCP
ITGHPVPNITWFHGGQPIVTATGLTHHILAAGQILQVANLSGGSQGEFSCLAQNEAGVLM
QKASLVIQDYWWSVDRLATCSASCGNRGVQQPRLRCLLNSTEVNPAHCAGKVRPAVQPIA
CNRRDCPSRWMVTSWSACTRSCGGGVQTRRVTCQKLKASGISTPVSNDMCTQVAKRPVDT
QACNQQLCVE
Download sequence
Identical sequences G7PSB0
9544.ENSMMUP00000024184 ENSMMUP00000024184 ENSMMUP00000024184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]