SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024413 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024413
Domain Number 1 Region: 10-76
Classification Level Classification E-value
Superfamily SNARE fusion complex 1.67e-22
Family SNARE fusion complex 0.0000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024413   Gene: ENSMMUG00000018559   Transcript: ENSMMUT00000026089
Sequence length 100
Comment pep:known chromosome:MMUL_1:1:10801918:10818765:1 gene:ENSMMUG00000018559 transcript:ENSMMUT00000026089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGPTAAPGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQF
ETSAAKLKRKYWWKNCKMWAIGITVLLIFIIIIIAWVTRV
Download sequence
Identical sequences ENSMMUP00000024413 ENSMMUP00000024413 9544.ENSMMUP00000024413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]