SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024432 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024432
Domain Number 1 Region: 179-467,576-618
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.78e-73
Family FAD-linked reductases, N-terminal domain 0.00024
Further Details:      
 
Domain Number 2 Region: 452-566
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.4e-25
Family L-aminoacid/polyamine oxidase 0.00025
Further Details:      
 
Domain Number 3 Region: 69-175
Classification Level Classification E-value
Superfamily Homeodomain-like 3.14e-20
Family SWIRM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024432   Gene: ENSMMUG00000018575   Transcript: ENSMMUT00000026109
Sequence length 619
Comment pep:known chromosome:MMUL_1:4:18236641:18267720:1 gene:ENSMMUG00000018575 transcript:ENSMMUT00000026109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLILPPLLKDSVAAPLLSAYYPDCVGMSPSCTSTNRAAATGNGSPGKLEHSKAAPSVHVP
GMNRYFQPFYQPNECGKALCVRPDVMELDELYEFPEYSRDPTMYLALRNLILALWYTNCK
EALTPQKCIPHIIVRGLVRIRCVQEVERILYFMTRKGLINTGVLSVGADQYLLPKDYHNK
SVIIIGAGPAGLAAARQLHNFGIKVTVLEAKDRIGGRVWDDKSFKGVTVGRGAQIVNGCI
NNPVALMCEQLGISMHKFGERCDLIQEGGRITDPTIDKRMDFHFNALLDVVSEWRKDKTQ
LQDVPLGEKIEEIYKAFIKESGIQFSELEGQVLQFHLSNLEYACGSNLHQVSARSWDHNE
FFAQFAGDHTLLTPGYSVIIEKLAEGLDIRLKSPVQSVDYSGDEVQVTTTDGTGYSAQKV
LVTVPLALLQKGAIQFNPPLSEKKMKAINSLGAGIIEKIALQFPYRFWDSKVQGADFFGH
VPPSASKRGLFAVFYDMDPQKKHSVLMSVIAGEAVASVRTLDDKQVLQQCMATLRELFKE
QEVPDPTKYFVTRWSTDPWIQMAYSFVKTGGSGEAYDIIAEDIQGTIFFAGEATNRHFPQ
TVTGAYLSGVREASKIAAF
Download sequence
Identical sequences 9544.ENSMMUP00000034382 ENSMMUP00000034382 ENSMMUP00000024432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]