SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024503 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024503
Domain Number 1 Region: 259-523
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-80
Family Protein kinases, catalytic subunit 0.0000000208
Further Details:      
 
Domain Number 2 Region: 118-246
Classification Level Classification E-value
Superfamily SH2 domain 8.72e-35
Family SH2 domain 0.000037
Further Details:      
 
Domain Number 3 Region: 57-139
Classification Level Classification E-value
Superfamily SH3-domain 2.04e-16
Family SH3-domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024503   Gene: ENSMMUG00000018627   Transcript: ENSMMUT00000026181
Sequence length 527
Comment pep:known chromosome:MMUL_1:5:43333100:43387702:-1 gene:ENSMMUG00000018627 transcript:ENSMMUT00000026181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTCFSDNTIQSVFCCCCCCSVQKRQVRTQISLSPDEELPEKHTQHRRPWLSQLSNKKQSN
TGCVQPSKRKPLPPLPPSEVAEEKIQVKALYDFLPREPCNLALRRAEEYLILEKYNPHWW
KARDRLGNEGLIPSNYVTENKITNLEIYEWYHRNITRNQAERLLRQESKEGAFIVRDSRH
LGSYTISVFIGARRSTEAAIKHYQIKKNDSGQWYVTERHVFQSVPELIWYHQHNAAGLMT
RLRYPVGLMGSCLPATAGFSYEKWEIDPSELAFIKEIGSGQFGVVHLGEWRSHIQVAIKA
INEGSMSEEDFIEEAKVMMKLSHSKLVQLYGVCTQWKPLYIVTEFMENGCLLNYLRENKG
KLRKEMLLSVCQDICEGMEYLERNGYIHRDLAARNCLVSSTCTVKISDFGMTRYVLDDEY
VSSFGAKFPIKWSPPEVFLFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAIS
EGFRLYRPHLAPMSIYEVMYSCWHEKPKGRPTFAELLRALTELAETW
Download sequence
Identical sequences G7P5J3
XP_014993824.1.72884 ENSMMUP00000024503 9544.ENSMMUP00000024503 ENSMMUP00000024503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]