SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024507 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024507
Domain Number 1 Region: 41-120
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000131
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 125-169
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000115
Family Hairy Orange domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024507   Gene: ENSMMUG00000018629   Transcript: ENSMMUT00000026185
Sequence length 207
Comment pep:known chromosome:MMUL_1:11:26399300:26401190:-1 gene:ENSMMUG00000018629 transcript:ENSMMUT00000026185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEGIPHLQERQLLEHRDFIGLDYSSLYMCKPKRSMKRDDTKDTYKLPHRLIEKKRRDRI
NECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQQHQKIIALQNGERSL
KSPIQSDLDAFHSGFQTCAKEVLQYLSRFESWTPREPRCVQLINHVHAVATLFLPTPQLL
TQQVPLSKGTGAPSAAGSAAAPCLERA
Download sequence
Identical sequences ENSMMUP00000024507 ENSMMUP00000024507 9544.ENSMMUP00000024507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]