SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024573 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024573
Domain Number 1 Region: 39-294
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-96
Family Protein kinases, catalytic subunit 0.0000113
Further Details:      
 
Domain Number 2 Region: 624-737
Classification Level Classification E-value
Superfamily KA1-like 7.52e-33
Family Kinase associated domain 1, KA1 0.00019
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000024573
Domain Number - Region: 304-355
Classification Level Classification E-value
Superfamily UBA-like 0.000138
Family UBA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024573   Gene: ENSMMUG00000018672   Transcript: ENSMMUT00000026252
Sequence length 737
Comment pep:known chromosome:MMUL_1:19:51693073:51737844:1 gene:ENSMMUG00000018672 transcript:ENSMMUT00000026252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HGTLGSGRSSDKGPSWSSRSLGARCRNSIASCPEEQPHVGNYRLLRTIGKGNFAKVKLAR
HILTGREVAIKIIDKTQLNPSSLQKLFREVRIMKGLNHPNIVKLFEVIETEKTLYLVMEY
ASAGEVFDYLVSHGRMKEKEARAKFRQIVSAVHYCHQKNIVHRDLKAENLLLDAEANIKI
ADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDIWSLGVILYTLVSGSLPFD
GHNLKELRERVLRGKYRVPFYMSTDCESILRRFLVLNPAKRCTLEQIMKDKWINIGYEGE
ELKPYTEPEEDFGDTKRIEVMVGMGYTREEIKEALTSQKYNEVTATYLLLGRKTEEGGDR
GAPGLALARVRAPSDTTNGTSSSKGTSHSKGQRSSSSTYHRQRRHSDFCGPSPAPLHPKR
SPTSTGEAELKEERLPGRKASCSAAGSGSRGLPPSSPMVSSAHNPNKAEIPERRKDSTST
PNNLPPSMMTRRNTYVCTERPGAERPSLLPNGKENRSRPVRVGPAPQRGHCHPPGQGQAA
TLFKGVTRRSAKQGGWILREKRVRGAGGGSWDSGTPTAQIIIMNTAKCLPRSHPKISVRL
FSRGCSESQRQVADEPERIGGPEVTSCHLPWDQTETTPRLLRFPWSVKLTSSRPPEALMA
ALRQATAAARCRCRQPQPFLLACLHGGAGGPEPLSHFEVEVCQLPRPGLRGVLFRRVAGT
ALAFRTLVTRISNDLEL
Download sequence
Identical sequences ENSMMUP00000024573 ENSMMUP00000024573 9544.ENSMMUP00000024573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]