SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024596 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024596
Domain Number 1 Region: 959-1229
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1e-71
Family Tandem AAA-ATPase domain 0.0000261
Further Details:      
 
Domain Number 2 Region: 705-957
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.35e-54
Family Tandem AAA-ATPase domain 0.0000695
Further Details:      
 
Domain Number 3 Region: 464-511,538-584
Classification Level Classification E-value
Superfamily Chromo domain-like 2.75e-18
Family Chromo domain 0.013
Further Details:      
 
Domain Number 4 Region: 342-416
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.44e-16
Family PHD domain 0.002
Further Details:      
 
Domain Number 5 Region: 606-675
Classification Level Classification E-value
Superfamily Chromo domain-like 2.36e-16
Family Chromo domain 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000024596
Domain Number - Region: 173-213
Classification Level Classification E-value
Superfamily HMG-box 0.0381
Family HMG-box 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024596   Gene: ENSMMUG00000018685   Transcript: ENSMMUT00000026275
Sequence length 1940
Comment pep:known chromosome:MMUL_1:11:6722127:6768010:-1 gene:ENSMMUG00000018685 transcript:ENSMMUT00000026275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKP
RDPKIPKSKRQKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKL
GPKKEKKSKSKRKEEEEEDDDDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKA
FSQLIGPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGASVAAAAAAAVAVVESM
VTATEVAPPPPPVEVPIRKAKTKEGKGPNARRKPKGSPRVPDAKKPKPKKVAPLKIKLGG
FGSKRKRSSSEDDDLDVESDFDDASINSYSVSDGSTSRSSRSRKKLRTTKKKKKGEEEVT
AVDGYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQ
WEAKEDNSEGEEILEEVGGDLEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPL
PEIPNGEWLCPRCTCPALKGKVQKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGRPE
RQFFVKWQGMSYWHCSWVSELQLELHCQVMFRNYQRKNDMDEPPSGDFGGDEEKSRKRKN
KDPKFAEMEERFYRYGIKPEWMMIHRILNHSVDKKGHVHYLIKWRDLPYDQASWESEDVE
IQDYDLFKQSYWNHRELMRGEEGRPGKKLKKVKLRKLERPPETPTVDPTVKYERQPEYLD
ATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLV
SAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKE
ASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLL
TGTPLQNNLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKA
DVFKNMPSKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCN
HPYLFPVAAMEAPKMPNGMYDGSALIRASGKLLLLQKMLKNLKEGGHRVLIFSQMTKMLD
LLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADT
VIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKKKMMLTHLVVR
PGLGSKTGSMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDR
NQDETEDTELQGMNEYLSSFKVAQYVVREEEMGEEEEVEREIIKQEESVDPDYWEKLLRH
HYEQQQEDLARNLGKGKRIRKQVNYNDGSQEDRGVCGRPRPPPMGRSTRAVGPAHLPSLP
PDWQDDQSDNQSDYSVASEEGDEDFDERSEAPRRPSRKGLRNDKDKPLPPLLARVGGNIE
VLGFNARQRKAFLNAIMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEPGA
DGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGRWSMPELAEVEENKKMSQ
PGSPSPKTPTPSTPGDTQPNTPAPAPPAEDGIKIEENSLKEEESIEGEKEVKSVAPETAI
ECTQPPAPASEDEKVVAEPPEGEEKVEKAEVKERTEEPMETEPKGAADVEKVEEKSAIDL
TPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNIADGGFTELHSLW
QNEERAATVTKKTYEIWHRRHDYWLLAGIINHGYARWQDIQNDPRYAILNEPFKGEMNRG
NFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMSEDPSHPSMALNTRFAEVECLAESH
QHLSKESMAGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNI
LSRLANRAPEPTPQQVAQQQ
Download sequence
Identical sequences ENSMMUP00000024596 9544.ENSMMUP00000024594 ENSMMUP00000024594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]