SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024599 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024599
Domain Number 1 Region: 126-181
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0000366
Family SNARE fusion complex 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000024599
Domain Number - Region: 6-119
Classification Level Classification E-value
Superfamily t-snare proteins 0.000361
Family t-snare proteins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024599   Gene: ENSMMUG00000018689   Transcript: ENSMMUT00000026278
Sequence length 214
Comment pep:known chromosome:MMUL_1:16:55885302:55902875:-1 gene:ENSMMUG00000018689 transcript:ENSMMUT00000026278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLYQQTHKQVHEIQSRMGRLETADKQSVQIVENEIQASIDQIFSRLERLEILSSKEPP
NKRQNAKLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPM
DESLQFNSSLQKVHHGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMR
LIEKRAFQDKYFMIGGMLRSCQTAHCEGRSAGSS
Download sequence
Identical sequences ENSMMUP00000024597 9544.ENSMMUP00000024597 ENSMMUP00000024599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]