SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024709 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024709
Domain Number 1 Region: 71-401
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 6.97e-59
Family Carboxylesterase 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024709   Gene: ENSMMUG00000018774   Transcript: ENSMMUT00000026395
Sequence length 401
Comment pep:known chromosome:MMUL_1:2:135944324:135971710:-1 gene:ENSMMUG00000018774 transcript:ENSMMUT00000026395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLKALCLGLLCVIFVSHFYTPMPDNIEESWKIMALDAIAKTCTFTAMCFENMGIMRYEE
FISMIFRLDYTQPLSDEYITVTDTTFVDIPVRLYLPKRKSETRRRAVIYFHGGGFCFGSS
KQRAFDFLNRWTANTLDAVVVGVDYRLAPQHHFPAQFEDGLAAVKFFLLEKILTKYGVDP
TRICISGDSSGGNLATAVTQQVQNDAEIKHKIKMQVLLYPGLQITDSYLPSHRENEHGIV
LTRDVAIKLVSLYFTKDEALPRAMRRNQHMPLESRHLFKFVNWSILLPEKYRKDYVYTEP
ILGGLSYSLPGLTDSRALPLLANDSQLQNLPLTYILTCQHDVLRDDGLMYVTRLRNVGVQ
VVHDHIEDGIHGALSYMTSPFYLRLGLRIRDMYVSWLDKNL
Download sequence
Identical sequences A0A0D9RHL6 A0A2K6CAJ6 F6ZWT8 G8F456
9544.ENSMMUP00000024709 ENSMMUP00000024709 ENSMMUP00000024709 XP_001106757.2.72884 XP_005546184.1.63531 XP_008006885.1.81039 XP_011709238.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]