SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024746 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024746
Domain Number 1 Region: 606-812
Classification Level Classification E-value
Superfamily Fibronectin type III 7.82e-33
Family Fibronectin type III 0.00057
Further Details:      
 
Domain Number 2 Region: 804-916
Classification Level Classification E-value
Superfamily Fibronectin type III 1.98e-25
Family Fibronectin type III 0.00068
Further Details:      
 
Domain Number 3 Region: 321-413
Classification Level Classification E-value
Superfamily Immunoglobulin 4.6e-20
Family I set domains 0.0000322
Further Details:      
 
Domain Number 4 Region: 236-329
Classification Level Classification E-value
Superfamily Immunoglobulin 1.21e-18
Family I set domains 0.00011
Further Details:      
 
Domain Number 5 Region: 430-514
Classification Level Classification E-value
Superfamily Immunoglobulin 1.43e-18
Family I set domains 0.0099
Further Details:      
 
Domain Number 6 Region: 510-612
Classification Level Classification E-value
Superfamily Immunoglobulin 6.97e-18
Family I set domains 0.023
Further Details:      
 
Domain Number 7 Region: 35-125
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000656
Family I set domains 0.0000582
Further Details:      
 
Domain Number 8 Region: 138-223
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000358
Family I set domains 0.0000186
Further Details:      
 
Domain Number 9 Region: 905-1000
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000108
Family Fibronectin type III 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024746   Gene: ENSMMUG00000018797   Transcript: ENSMMUT00000026435
Sequence length 1040
Comment pep:known chromosome:MMUL_1:1:165342619:165374459:-1 gene:ENSMMUG00000018797 transcript:ENSMMUT00000026435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTATRRKPHLLLVAAVALVSSSAWSSALGSPTTFGPVFEDQPLSVLFPEESTEEQVLLA
CRARASPPATYRWKMNGTEMKLEPGSRHQLVGGNLVIMNPTKAQDAGVYQCLASNPVGTV
VSREAILRFGFLQEFSKEERDPVKTHEGWGVMLPCNPPAHYPGLSYRWLLNEFPNFIPTD
GRHFVSQTTGNLYIARTNASDLGNYSCLATSHMDFSTKSVFSKFAQLNLAAEDTRLFAPS
IKARFPAETYALVGQQVTLECFAFGNPVPRIKWRKVDGSLSPQWTTAEPTLQIPSVSFED
EGTYECEAENSKGRDTVQGRIIVQAQPEWLKVISDTEADIGSNLRWGCAAAGKPRPTVRW
LRNGEPLASQNRVEVLAGDLRFSKLSLEDSGMYQCVAENKHGTIYASAELAVQALAPDFR
LNPVRRLIPAARGGEIVIPCQPRAAPKAVVLWSKGTEILVNSSRVTVTPDGTLIIRNISR
SDEGKYTCFAENFMGKANSTGILSVRDATKITLAPSSADINLGDNLTLQCHASHDPTMDL
TFTWTLDDFPIDFDKPGGHYRRTNVKETIGDLTILNAQLRHGGKYTCMAQTVVDSASKEA
TVLVRGPPGPPGGVVVRDIGDTTIQLSWSRGFDNHSPIAKYTLQARTPPAGKWKQVRTNP
ANIEGNAETAQVLGLTPWMDYEFRVIASNILGTGEPSGPSSKIRTKEAAPSVAPSGLSGG
GGAPGELIVNWTPMSREYQNGDGFGYLLSFRRQGSTHWQTARVPGADAQYFVYSNESVRP
YTPFEVKIRSYNRRGEGPESLTALVYSAEEEPRVAPTKVWAKGVSSSEMNVTWEPVQQDM
NGILLGYEIRYWKAGDKEAAADRVRTAGLDTSARVSGLHPNTKYHVTVRAYNRAGTGPAS
PSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLYQNDLHLTPT
LHLTSKNWIEIPVPEDIGHALVQIRTTGPGGDGIPAEVHIVRNGGTSMMVENLAVRPAPH
PGAIVSHSVAMLILIGSLEL
Download sequence
Identical sequences G7PE72 I2CY45
NP_001252701.1.72884 ENSMMUP00000024746 9544.ENSMMUP00000024746 ENSMMUP00000024746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]